KEGG   Plasmodium falciparum Dd2: PFDG_02013Help
Entry
PFDG_02013        CDS       T01051                                 

Definition
hypothetical protein
Orthology
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.1.2.15]
Organism
pfd  Plasmodium falciparum Dd2
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
AA seq 400 aa AA seqDB search
MNITENNLLELLSLKNYDYYLKYYNYEHVERKHISFNNSGNICYCNASLQLILSIKPLCI
YLLKKLKKISFNTKSKYKGDILKTVCDLIEEVYGKTNSDSNNNNNNSNSNNKNKSYIICT
NKHINLLKKIKKYNNNIIINAQNDAHEFLLMLLNFINVECNRYLKIPENFDIKLNDKDNK
QNAGDKYWIKYLFKDNSIVTDLLGFQNISSITCINCGHTRYSFEFCIDLGLEFHEENMKS
TNLIDLLKNNIIQEEHFCYLDCENCKLKKTSRVKKGIYRLPNLYMIIYIKRFKWIYDQRT
NYYNNKIKKIDTTVLLPLDGIIDFTSFSHMSTHKSLINSKYIIESIICHTGNCYNGHYTC
IVKYSDGFYKCNDEKIRKINNPYSSENINDIYLLLLRRLP
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaatattaccgaaaataaccttctcgagctcctatcattaaaaaattatgattattat
ttaaaatattataactatgaacatgttgaaagaaaacacatttcgtttaataacagcggg
aacatatgttactgtaacgcttctttacaattaatattatctataaaacctttgtgtatt
tatttattgaaaaaattaaaaaaaatatcttttaatacaaaatctaaatataaaggagat
atattaaaaactgtttgtgatttaatagaagaagtatatgggaaaaccaactcagatagt
aataataataataataatagtaatagtaataataaaaataaaagttatataatttgtaca
aataaacatataaatttattaaaaaaaattaaaaaatataataataatattataattaat
gctcaaaatgatgcacatgaatttttattgatgttattaaattttataaatgtggaatgt
aatagatatttaaagataccagaaaacttcgatataaaattaaatgataaagataataaa
caaaatgctggagataagtattggataaaatatttatttaaagataacagtattgtgacc
gacttattaggctttcaaaatatttcaagtattacatgtattaattgtggacataccaga
tatagttttgaattctgtattgacttaggtttagagtttcacgaagaaaatatgaaaagt
acaaatcttatagacctattaaaaaataatattatacaagaagaacatttctgttattta
gattgtgaaaattgtaaattaaaaaaaacaagtcgagttaaaaaaggaatatatagattg
ccaaacttgtatatgattatttatattaaaagatttaaatggatatatgatcaacgtaca
aattattataataataaaatcaaaaaaattgatactactgttttgttaccattagatggt
attattgattttacatccttttcacatatgtcaactcataaatcattaattaattcaaaa
tatattatagaaagtattatatgtcatacaggaaattgttataatggtcattatacttgt
attgttaaatatagtgatggattttataaatgtaacgatgaaaaaattaggaaaataaac
aatccatacagctcagaaaatattaacgacatatatttgttgctactcaggcgattaccc
taa

DBGET integrated database retrieval system