KEGG   Plasmodium falciparum Dd2: PFDG_02013Help
Entry
PFDG_02013        CDS       T01051                                 

Definition
hypothetical protein
Orthology
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.4.19.12]
Organism
pfd  Plasmodium falciparum Dd2
Brite
Enzymes [BR:pfd01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PFDG_02013
Peptidases [BR:pfd01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PFDG_02013
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
AA seq 400 aa AA seqDB search
MNITENNLLELLSLKNYDYYLKYYNYEHVERKHISFNNSGNICYCNASLQLILSIKPLCI
YLLKKLKKISFNTKSKYKGDILKTVCDLIEEVYGKTNSDSNNNNNNSNSNNKNKSYIICT
NKHINLLKKIKKYNNNIIINAQNDAHEFLLMLLNFINVECNRYLKIPENFDIKLNDKDNK
QNAGDKYWIKYLFKDNSIVTDLLGFQNISSITCINCGHTRYSFEFCIDLGLEFHEENMKS
TNLIDLLKNNIIQEEHFCYLDCENCKLKKTSRVKKGIYRLPNLYMIIYIKRFKWIYDQRT
NYYNNKIKKIDTTVLLPLDGIIDFTSFSHMSTHKSLINSKYIIESIICHTGNCYNGHYTC
IVKYSDGFYKCNDEKIRKINNPYSSENINDIYLLLLRRLP
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaatattaccgaaaataaccttctcgagctcctatcattaaaaaattatgattattat
ttaaaatattataactatgaacatgttgaaagaaaacacatttcgtttaataacagcggg
aacatatgttactgtaacgcttctttacaattaatattatctataaaacctttgtgtatt
tatttattgaaaaaattaaaaaaaatatcttttaatacaaaatctaaatataaaggagat
atattaaaaactgtttgtgatttaatagaagaagtatatgggaaaaccaactcagatagt
aataataataataataatagtaatagtaataataaaaataaaagttatataatttgtaca
aataaacatataaatttattaaaaaaaattaaaaaatataataataatattataattaat
gctcaaaatgatgcacatgaatttttattgatgttattaaattttataaatgtggaatgt
aatagatatttaaagataccagaaaacttcgatataaaattaaatgataaagataataaa
caaaatgctggagataagtattggataaaatatttatttaaagataacagtattgtgacc
gacttattaggctttcaaaatatttcaagtattacatgtattaattgtggacataccaga
tatagttttgaattctgtattgacttaggtttagagtttcacgaagaaaatatgaaaagt
acaaatcttatagacctattaaaaaataatattatacaagaagaacatttctgttattta
gattgtgaaaattgtaaattaaaaaaaacaagtcgagttaaaaaaggaatatatagattg
ccaaacttgtatatgattatttatattaaaagatttaaatggatatatgatcaacgtaca
aattattataataataaaatcaaaaaaattgatactactgttttgttaccattagatggt
attattgattttacatccttttcacatatgtcaactcataaatcattaattaattcaaaa
tatattatagaaagtattatatgtcatacaggaaattgttataatggtcattatacttgt
attgttaaatatagtgatggattttataaatgtaacgatgaaaaaattaggaaaataaac
aatccatacagctcagaaaatattaacgacatatatttgttgctactcaggcgattaccc
taa

DBGET integrated database retrieval system