KEGG   Plasmodium falciparum Dd2: PFDG_02163Help
Entry
PFDG_02163        CDS       T01051                                 

Definition
hypothetical protein similar to NADPH-cytochrome p450 reductase
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
pfd  Plasmodium falciparum Dd2
Brite
Enzymes [BR:pfd01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     PFDG_02163
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
AA seq 630 aa AA seqDB search
MGLGSKQYKHFNKIAKKLDTFLLNFKAHQISETIYGDDDDNIYHDFEVWKNKFFMQLPKL
LNMKNIPIYVPKEDIIELTSWRDMAEIKLDIQYYDHLIEEDNKKEKNVVTENIINESVTN
NQQLLNHNQNNLSINNKSNYISTDIIGKFYFNHLTGKVISNTKLLKNVDLSNNGDKVNHI
NISIEDNIIYKAADNLSILTKNTKEVITWWLKRLNIDEKEKTKKFTFVKRNKLIDNSFTM
NDPKDDVKNETFNNDVNKGNNKTNIDYNSNNNGNNNNNNNYNEYDDNHIYVPFPTPCSVE
DALSYYCDLTTIPRLNILKKFKCFIKDIEELKMFNFILSNNQRNTFFNICKECDMTFIEF
VDMFMQSAVFELSPFLQLIPRNTPKSYTISSSPKESKDILSLTVKKKQYCIHSLRRALKN
LKTNDMFPKLNEQKLRELCSRRWFKGSSSYYLTEELNVNDIVKFNIKPSKFVLPENIQSS
HIIMIATGAGIAPFKAFLSEFIYYDQQIVKDNFVRKGKRILFYGCRKREVDFLYEMEIMD
ALDKKHIDETYFAFSRDQESKIYVQDLILQKKELVWNLLQKGAYIYVCGNSNMSKDVNKT
INSLPLHFKQNDKKFTKKLKKSGRYIYEIW
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgggtttaggtagcaaacaatataaacattttaataagatagctaaaaaacttgataca
tttcttttaaattttaaagctcatcaaattagtgaaactatttatggtgatgatgatgat
aatatatatcatgattttgaagtatggaaaaataaattttttatgcaacttccaaaatta
ttaaatatgaaaaatatacctatttatgtacccaaagaagatattattgaattgacatct
tggagagacatggcagaaattaagttagatatacaatattatgatcatttaatagaagaa
gataataaaaaagaaaaaaatgtagtaacagaaaatattataaatgaaagtgttacaaat
aatcagcaattattgaatcataaccaaaacaatttaagtattaataacaaatcaaattat
ataagtacagatataatagggaaattttattttaatcatcttacaggaaaagttatttcc
aatacaaaattattaaaaaatgtggatttatcgaataacggagataaagttaatcatatc
aatattagcattgaggataatattatttataaagctgcagataatttatctattttaaca
aaaaatacaaaagaggtcattacctggtggttaaaacgattaaacatagatgaaaaagag
aaaacaaaaaaattcacctttgtaaaaagaaataaattaatagataattcatttactatg
aatgatccaaaggatgatgtaaaaaatgaaacatttaacaatgatgttaataaagggaat
aataaaacaaatattgattataatagtaacaataatggtaataataataataataataat
tataatgaatatgatgataatcatatatatgtaccctttccaacaccatgtagtgttgaa
gatgcattatcatattattgtgatctaacaactattccaagattgaatattttaaaaaag
tttaaatgttttattaaagatatagaagaacttaaaatgtttaactttattttatctaac
aatcaaaggaatacattctttaacatatgtaaagaatgtgatatgacatttatagaattt
gttgatatgttcatgcaaagtgctgtatttgaattatctccatttttacaattaatacct
aggaatactcctaaaagttatacaatttcttcttctccaaaggaatcaaaagatatatta
tcattaactgttaagaagaaacaatattgtatacattctcttagaagagcattaaaaaat
ttaaaaacaaatgatatgtttccaaaattaaatgaacaaaagctacgagaactttgtagc
agaagatggtttaagggatcatcctcatactatctaacagaagaattaaatgtaaatgat
atagttaaattcaatataaaaccttccaaatttgttctcccagaaaatattcaatcatct
catattattatgattgctacaggtgcaggaattgcaccttttaaagctttcctgagcgag
tttatatattatgatcaacaaattgtaaaagataattttgtaagaaaaggaaaaagaata
ttgttttatgggtgcagaaaaagagaagtagacttcctctacgaaatggaaattatggat
gctcttgacaagaaacatattgatgaaacatactttgcattctcacgagatcaagaaagt
aaaatatatgtccaagatttaattcttcagaaaaaggaacttgtatggaatttattacaa
aagggtgcatatatttatgtttgtggaaatagtaatatgagtaaagatgtaaacaaaacc
attaatagtttgcctctccattttaaacaaaatgataaaaaatttacgaaaaagttgaaa
aaatctgggcgttatatctatgagatatggtaa

DBGET integrated database retrieval system