KEGG   Plasmodium falciparum Dd2: PFDG_02850Help
Entry
PFDG_02850        CDS       T01051                                 

Definition
conserved hypothetical protein
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.4.19.12]
Organism
pfd  Plasmodium falciparum Dd2
Brite
Enzymes [BR:pfd01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PFDG_02850
Peptidases [BR:pfd01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PFDG_02850
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
AA seq 535 aa AA seqDB search
MFLNSSLQCLSKILKFSNYFLNGSFWNHINYSNPVGQHGRLAKAYYETLTEMWKINKRDC
PYAPKVLKEAISEKRDEFYGYQQHDSQELLAFLLDGLHEDLNLIRKKPYYEEKLQGGVDK
LDVDVAEASWNRHKEINNSIIVDLFQGQYRSRLQCPKCKKVSITFDPFMYLSIPLPPKKN
HRVWFHVILSRDIPIAIRFSCTYNGSQEVLKLKIFFLNIIKNMKNKKRNILLHSKSIIKN
NKYPHEGANAFNFHSKFLDDNKNDLYEENEYNNNNNISDDVTNYIKALKNKSKITNTLKE
QDIQIIYESICSMCNISSIEELEINNLCFLYTKLKNLACNNFFQVLNNSDFVTEPHTRND
ECLEVLTNSTVTTNNTSLKDEEDINIRTETNDKKTVKNKHSTNKIVKKRKGLLSNPLRKG
TLGTDHQKYYQEDNVEENIENVNEINIKEEDNKIINNNNDHIKKNSNEYISYNDLLNDQA
FINHNYHYLNDKYFSVLIVPLCKDEQLLYKMKNNDLPLLYNIPFNYTLDLEINIR
NT seq 1693 nt NT seq  +upstreamnt  +downstreamnt
atgtttttaaattcatcattacaatgtttatctaagattttaaaattttcaaattatttt
ttaaatggttctttttggaatcatataaattattcaaatccggttggtcaacatgggaga
ttagcaaaagcatattatgagactttaacagaaatgtggaaaattaataaaagagattgt
ccttatgcacctaaggttttaaaagaggcgataagtgaaaagagggatgaattttatgga
tatcaacaacatgattcacaagaattattagcatttctattagatggattacatgaagat
ttaaatttgattagaaaaaaaccttattatgaagagaagttacaagggggtgtagataaa
ttagatgttgatgtagctgaagcttcttggaatagacataaagaaattaataattccata
attgtcgatttatttcaaggtcaatatagatcaagattacagtgtcctaaatgtaaaaaa
gttagtataacatttgatccttttatgtatttatccattccattacctccaaaaaaaaat
catcgagtatggtttcatgtgatactaagtagagatattcctatagctatcagattttca
tgtacatataatggttcgcaagaagtattaaaattaaaaattttctttttgaatataata
aagaatatgaaaaacaaaaaaagaaatatattattacatagtaaatccataatcaaaaat
aataaatatcctcatgagggtgccaatgcattcaatttccattcgaaatttttagatgat
aataagaatgatttatatgaagaaaatgaatataacaataataataatataagtgatgat
gttactaattatattaaagctttgaaaaataaatccaaaattaccaacactctgaaagaa
caagatatacaaataatatatgaaagcatttgttctatgtgtaatatatcttctattgaa
gaattagaaattaataatctttgttttctttatacgaaattaaaaaatctagcatgtaat
aatttttttcaagtgttaaataattccgattttgttacagaaccacatacaagaaatggt
aaagggcattagccatatctttgtttatatacttcctaaaatatttggacatttaattga
taaaaatattgatttaaaagtagacgagtgtttagaagtattaacgaattcaactgttac
tacaaataatacgagtcttaaagatgaagaagatattaatataagaacagaaacgaatga
taagaaaactgtaaaaaataaacattctactaataaaattgtaaaaaaaagaaaaggatt
attatccaaccctttaagaaaaggaacacttggaacagatcatcaaaaatattatcaaga
agataatgttgaagaaaatatagaaaatgttaatgaaataaatattaaagaagaagataa
taaaattataaataataataatgatcatattaaaaaaaattcaaacgaatatatatctta
taatgatttattaaatgatcaagcttttataaatcataattatcattatcttaatgacaa
atatttttctgttcttattgtgccattgtgtaaagatgaacaacttttatacaaaatgaa
aaataatgatttacctttattatataatattccttttaattacaccttagacctagagat
taatataaggtga

DBGET integrated database retrieval system