KEGG   Plasmodium falciparum Dd2: PFDG_02934Help
Entry
PFDG_02934        CDS       T01051                                 

Definition
conserved hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
pfd  Plasmodium falciparum Dd2
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pfd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PFDG_02934
Enzymes [BR:pfd01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     PFDG_02934
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
AA seq 609 aa AA seqDB search
MSEYKKYNVPSHEIYDVILFGGGLFNCWLYYYLKLKNSELSIIIVEKEENLGGYIKTYTY
NIDDKKILVELGPNMFKLCNESYNLINKLNLLSSVRLLDDTLIRYIYIKNDKLYPLYLNI
FSYLSFPLINISNKIKLLFKLIFKQYKNLNSYTNDISVENYMNDNFDSQHYNFLLLPFIY
GSCAGNGKISAVSFFSRNLKLFHNKVNSLYIWNEKIKSEEKNRNIKCVNNNTFIYQHMNK
KKKNFNLFTPCYNFFYISNKNMKMDVYLNVLYNYYSSNKKTEKKNVFNYICYRIPILLLH
MKQFSINIFRHISIFLKCTYQFFYPFLMLPDLAKWTTSHFDDEKKKKKNLIGKTVTFKNG
LYELIDKLQSHMNKEFIYTNHEVDFIEKAYNNLWMCNIKHENQNKTIYGKNIVLAVNSKI
CSNIMRNILPVNIRDILLNFSYSSIISISLYFKKSDINIPKNFFGFLSSDKCAHILGCFH
INNMFKERCHDDNKVLLTLYMGGSNHPNDITLDEYEIKEIISNDLKNIFDIYNDAQPNIL
KIHKWKDAIPFYSYNYEKLLKKVMEELNKLSYKNLYLDSGWITGTSISDRIRSAQDLCEY
IFSLTNLAS
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaatataaaaaatataatgtaccttcacatgaaatttatgatgttattttattt
gggggtggcttatttaattgctggctgtactattatttaaaattaaaaaattctgaactg
tctataataatagtagaaaaagaagaaaacttaggagggtatataaagacatatacatat
aatattgatgataaaaaaatattagtagagttaggtccgaatatgtttaaattatgtaat
gagagttataatttaattaataaacttaatttactttctagtgttagattattagacgat
acacttataagatatatatatataaaaaatgataaattatatccgttgtatttaaatata
ttttcttatttatctttccctttaataaatatttcaaataaaattaaattactcttcaaa
ttaatctttaaacaatataaaaatttaaattcatatacaaacgatatatctgtggaaaat
tatatgaacgataatttcgattcacaacattataattttttacttttaccttttatatat
ggctcgtgtgcaggtaatggcaaaatatctgcagtctccttcttctcaagaaatttaaag
ctttttcataataaagtgaactctttatatatatggaatgagaaaattaaaagcgaagaa
aaaaataggaatataaaatgtgttaataataatacttttatttatcaacatatgaataaa
aaaaaaaaaaattttaatttatttacaccatgttataattttttttacatttcaaataaa
aacatgaaaatggatgtatatttaaatgtcttatacaattactattcctcaaataagaag
acagaaaaaaaaaatgtatttaattatatttgttacaggattcctattttgttattacat
atgaaacaattttctattaatatatttcgtcatatttctatatttctaaaatgtacatac
caattcttttacccttttttaatgttacctgatctagccaaatggacgactagccatttt
gatgatgaaaaaaaaaaaaaaaaaaatttaattggaaaaactgttacctttaaaaatggt
ttatatgaattaatagataaattacagagtcatatgaataaagaatttatatatacaaat
catgaagtcgattttattgaaaaggcttataacaatttatggatgtgtaacatcaaacat
gaaaatcaaaataaaacaatatatggtaaaaacattgttttagctgtaaattcgaaaata
tgttctaatattatgaggaacattttaccggttaacataagagatatacttttaaatttt
tcgtattctagtattataagtatatcattatattttaagaaaagtgatataaatattcca
aaaaatttttttggatttttatcatctgataaatgtgcacatatcttgggatgttttcat
ataaataatatgtttaaagaaagatgtcatgatgataataaagtattattaactttatat
atgggtggatcaaatcatccaaatgatattactttagatgaatatgaaattaaagaaata
atttcaaacgatttaaaaaacatatttgatatatataatgatgcacaacctaatatttta
aaaatacacaaatggaaagacgcaataccattttattcatataattatgagaaactctta
aaaaaagttatggaggaattaaataaattgtcttataaaaatttgtacctcgattctgga
tggataactggaacgtcaatatcggatagaataagatctgcacaggatttgtgcgaatat
atcttttctctgacgaatcttgcatcataa

DBGET integrated database retrieval system