KEGG   Plasmodium falciparum Dd2: PFDG_03330Help
Entry
PFDG_03330        CDS       T01051                                 

Definition
acetyl-coenzyme a synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pfd  Plasmodium falciparum Dd2
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pfd01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pfd00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pfd00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:pfd00640]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
AA seq 1005 aa AA seqDB search
MNNLKSHGSLSKVDSVQINGMDIDTNIFLNMNSYPTKEIYDDENNKNDGNHNIKNFQAYK
AMYEESINNPEAFWGNLAKNNLIWYKLFTKVFLGNFKKGNINWFVNGKINACENCVDRWV
EKDPNKIALIWEQDCPDQYKKITYQKLLEKTCKVANLLKLIGVKKQDTVTIYLPMIPELV
YSMLACVRIGAIHNVVFAGYSAASLSDRIIDSRSTVLITSDFGLRGGKLTKLKQIADVAM
DMCGMIQTCIVFKNKTKMKDKNIQIKTPMENPIYNFTSFDSNSPQNFTINNSNDFIQIKS
THSHQSDHQNDFSLQQEDNNYTKNSNMSYTTSMYYHDNNLNHINTNKNNDHYNNNLNNKN
YLNNNINDQSPMYVHTMNHNDNNDDNNNNNNNNNVDDDNNSNIQNDEQSYFNQQNNTYNK
NDHSDDNNKNKGKTTLHKKITKNNPINHKISYSEKSYSKELINTDMVNNDNQFGDLKTKK
KFININNIITLYQDGISPNKQLFPDWIKIAQAILMELYXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXLFSMKPGCASLPFLGVQLEILDSKTLQPLSGNNVCGLLCIKSPWPGMLRTVY
GNHQRLIKTYFTMCPNYYFTGDGAFRDEDGYYWISGRIDDTLNVAGHRLGAAEIEHALVQ
HFYIAEAAVVSFHHNVKGEGILCFVVKKKGNIKNYSKGITDIVNNNNNNNRNELHNNSPF
LICSNNITDIEEFKKNFTDEKLIEQLKLYVRQVIGPIATPDLICVVPDLPKTRSGKIVRR
ILRCIANGITDFGDISTVSNYEVIETINNTLNECKKKLKDIEIKK
NT seq 3018 nt NT seq  +upstreamnt  +downstreamnt
atgaataatttgaagagtcatggaagtctatcaaaagtcgactctgttcaaatcaacggt
atggatatagatacaaatatttttcttaatatgaattcttaccctaccaaggaaatatat
gatgatgagaataataagaatgatggaaatcataacataaaaaatttccaagcatataaa
gcaatgtatgaagagagtataaataatccagaagctttttggggaaatttagcaaagaat
aatttaatatggtataaattatttactaaagtatttttaggtaattttaaaaaaggaaat
ataaattggtttgttaatgggaaaattaatgcttgtgaaaattgtgttgatagatgggtt
gaaaaagatcctaataaaattgcacttatatgggaacaagattgtccagatcaatataaa
aagattacatatcagaaattattagaaaagacttgtaaagtagctaatttattaaaactt
attggtgttaaaaaacaagacactgttactatttatttacctatgatacctgaattggtt
tattctatgctagcttgtgttcgtattggagctattcataatgtagttttcgctggttat
tcggcagctagcttgagcgatagaataatagattctagatctactgttttaattacttct
gattttggattgagaggtgggaaattaaccaaattaaaacaaattgctgatgtagctatg
gatatgtgtggaatgatacaaacatgcatagtattcaaaaataaaactaaaatgaaagat
aaaaatatacaaattaaaacacctatggaaaatcctatttataattttacaagttttgat
tctaatagtccacaaaattttacaattaataattctaatgattttattcaaataaaatca
actcattcccatcaaagtgatcatcaaaatgatttctctcttcagcaggaagataataat
tatacaaaaaactctaatatgtcttatactacgagtatgtattatcatgataataattta
aaccatataaacactaataaaaataacgatcattataacaataatttaaataataaaaat
tatttaaataataatattaatgatcaaagccctatgtatgttcataccatgaaccataat
gacaataatgatgataataataataataataataataacaatgtagatgatgataataat
agtaatatacaaaatgatgaacagtcttattttaatcaacaaaataatacatataacaaa
aatgatcattctgatgacaataataagaataaaggaaaaacaaccttacataaaaaaatt
acaaaaaataatcctataaatcataaaatttcttactcagaaaaaagctactcaaaagaa
ttaataaacactgacatgggtaaataacgataatcaatttggtgatttaaaaacaaacaa
aaaaatttataaatattaataatattataaccttgtatcaggatgggatatctccaaata
aacaattatttcctgactggataaaaatagcacaagccattttgatggaactttatnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnatttatttagtatgaaaccaggatgtgctagtttac
attcttaggtgttcaattagaaatattagattcaaaactttacaacctttaagtggtaat
aatgtatgtggtttattatgtataaagagcccatggccaggaatgttacgtacagtatat
ggaaatcatcaaagattaataaaaacatattttaccatgtgtcctaattattattttacc
ggagatggagcgttcagagatgaagatggatactattggatatctggacgaatcgatgat
acattaaatgtagcagggcacagattaggagcagcagaaattgaacatgcactagttcaa
catttttatattgctgaagcagctgttgtttcatttcatcataatgttaagggagaagga
attttatgttttgtcgttaaaaaaaaaggaaacataaaaaattatagtaaaggcattaca
gatattgttaataataataataacaataatagaaatgaattacataataatagtccattt
ttgatatgctctaataatattactgatattgaagaatttaaaaaaaattttaccgatgaa
aaattaatagaacaactaaaattatatgtaagacaagttattggacccatagcaacacct
gacctaatttgtgtggttccagatttgccaaaaaccagaagtggaaaaattgttagaaga
atattaagatgtatagcaaatggtataacagatttcggagatatttccactgtctcgaat
tatgaagttattgaaactattaataatacacttaatgaatgtaaaaaaaagttaaaggat
attgaaattaagaaataa

DBGET integrated database retrieval system