KEGG   Plasmodium falciparum Dd2: PFDG_03330Help
Entry
PFDG_03330        CDS       T01051                                 

Definition
acetyl-coenzyme a synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pfd  Plasmodium falciparum Dd2
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pfd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PFDG_03330
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PFDG_03330
   00620 Pyruvate metabolism
    PFDG_03330
   00640 Propanoate metabolism
    PFDG_03330
Enzymes [BR:pfd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PFDG_03330
Lipid biosynthesis proteins [BR:pfd01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PFDG_03330
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
AA seq 1005 aa AA seqDB search
MNNLKSHGSLSKVDSVQINGMDIDTNIFLNMNSYPTKEIYDDENNKNDGNHNIKNFQAYK
AMYEESINNPEAFWGNLAKNNLIWYKLFTKVFLGNFKKGNINWFVNGKINACENCVDRWV
EKDPNKIALIWEQDCPDQYKKITYQKLLEKTCKVANLLKLIGVKKQDTVTIYLPMIPELV
YSMLACVRIGAIHNVVFAGYSAASLSDRIIDSRSTVLITSDFGLRGGKLTKLKQIADVAM
DMCGMIQTCIVFKNKTKMKDKNIQIKTPMENPIYNFTSFDSNSPQNFTINNSNDFIQIKS
THSHQSDHQNDFSLQQEDNNYTKNSNMSYTTSMYYHDNNLNHINTNKNNDHYNNNLNNKN
YLNNNINDQSPMYVHTMNHNDNNDDNNNNNNNNNVDDDNNSNIQNDEQSYFNQQNNTYNK
NDHSDDNNKNKGKTTLHKKITKNNPINHKISYSEKSYSKELINTDMVNNDNQFGDLKTKK
KFININNIITLYQDGISPNKQLFPDWIKIAQAILMELYXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXLFSMKPGCASLPFLGVQLEILDSKTLQPLSGNNVCGLLCIKSPWPGMLRTVY
GNHQRLIKTYFTMCPNYYFTGDGAFRDEDGYYWISGRIDDTLNVAGHRLGAAEIEHALVQ
HFYIAEAAVVSFHHNVKGEGILCFVVKKKGNIKNYSKGITDIVNNNNNNNRNELHNNSPF
LICSNNITDIEEFKKNFTDEKLIEQLKLYVRQVIGPIATPDLICVVPDLPKTRSGKIVRR
ILRCIANGITDFGDISTVSNYEVIETINNTLNECKKKLKDIEIKK
NT seq 3018 nt NT seq  +upstreamnt  +downstreamnt
atgaataatttgaagagtcatggaagtctatcaaaagtcgactctgttcaaatcaacggt
atggatatagatacaaatatttttcttaatatgaattcttaccctaccaaggaaatatat
gatgatgagaataataagaatgatggaaatcataacataaaaaatttccaagcatataaa
gcaatgtatgaagagagtataaataatccagaagctttttggggaaatttagcaaagaat
aatttaatatggtataaattatttactaaagtatttttaggtaattttaaaaaaggaaat
ataaattggtttgttaatgggaaaattaatgcttgtgaaaattgtgttgatagatgggtt
gaaaaagatcctaataaaattgcacttatatgggaacaagattgtccagatcaatataaa
aagattacatatcagaaattattagaaaagacttgtaaagtagctaatttattaaaactt
attggtgttaaaaaacaagacactgttactatttatttacctatgatacctgaattggtt
tattctatgctagcttgtgttcgtattggagctattcataatgtagttttcgctggttat
tcggcagctagcttgagcgatagaataatagattctagatctactgttttaattacttct
gattttggattgagaggtgggaaattaaccaaattaaaacaaattgctgatgtagctatg
gatatgtgtggaatgatacaaacatgcatagtattcaaaaataaaactaaaatgaaagat
aaaaatatacaaattaaaacacctatggaaaatcctatttataattttacaagttttgat
tctaatagtccacaaaattttacaattaataattctaatgattttattcaaataaaatca
actcattcccatcaaagtgatcatcaaaatgatttctctcttcagcaggaagataataat
tatacaaaaaactctaatatgtcttatactacgagtatgtattatcatgataataattta
aaccatataaacactaataaaaataacgatcattataacaataatttaaataataaaaat
tatttaaataataatattaatgatcaaagccctatgtatgttcataccatgaaccataat
gacaataatgatgataataataataataataataataacaatgtagatgatgataataat
agtaatatacaaaatgatgaacagtcttattttaatcaacaaaataatacatataacaaa
aatgatcattctgatgacaataataagaataaaggaaaaacaaccttacataaaaaaatt
acaaaaaataatcctataaatcataaaatttcttactcagaaaaaagctactcaaaagaa
ttaataaacactgacatgggtaaataacgataatcaatttggtgatttaaaaacaaacaa
aaaaatttataaatattaataatattataaccttgtatcaggatgggatatctccaaata
aacaattatttcctgactggataaaaatagcacaagccattttgatggaactttatnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnatttatttagtatgaaaccaggatgtgctagtttac
attcttaggtgttcaattagaaatattagattcaaaactttacaacctttaagtggtaat
aatgtatgtggtttattatgtataaagagcccatggccaggaatgttacgtacagtatat
ggaaatcatcaaagattaataaaaacatattttaccatgtgtcctaattattattttacc
ggagatggagcgttcagagatgaagatggatactattggatatctggacgaatcgatgat
acattaaatgtagcagggcacagattaggagcagcagaaattgaacatgcactagttcaa
catttttatattgctgaagcagctgttgtttcatttcatcataatgttaagggagaagga
attttatgttttgtcgttaaaaaaaaaggaaacataaaaaattatagtaaaggcattaca
gatattgttaataataataataacaataatagaaatgaattacataataatagtccattt
ttgatatgctctaataatattactgatattgaagaatttaaaaaaaattttaccgatgaa
aaattaatagaacaactaaaattatatgtaagacaagttattggacccatagcaacacct
gacctaatttgtgtggttccagatttgccaaaaaccagaagtggaaaaattgttagaaga
atattaagatgtatagcaaatggtataacagatttcggagatatttccactgtctcgaat
tatgaagttattgaaactattaataatacacttaatgaatgtaaaaaaaagttaaaggat
attgaaattaagaaataa

DBGET integrated database retrieval system