KEGG   Plasmodium falciparum Dd2: PFDG_03386Help
Entry
PFDG_03386        CDS       T01051                                 

Definition
hypothetical protein
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
pfd  Plasmodium falciparum Dd2
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:pfd00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Structure
PDB: 

Jmol
AA seq 199 aa AA seqDB search
MNNIYPLVICGPSGVGKGTLIKKLLNEFPNYFYFSVSCTTRKKREKEKEGVDYYFIDKTI
FEDKLKNEDFLEYDNYANNFYGTLKSEYDKAKEQNKICLFEMNINGVKQLKKSTHIKNAL
YIFIKPPSTDVLLSRLLTRNTENQEQIQKRMEQLNIELHEANLLNFNLSIINDDLTLTYQ
QLKNYLLNSYIHLNNHTRN
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaataatatttatcccctggttatttgtggtccttcgggtgttggtaaaggtaccttg
ataaaaaagctgttgaatgaatttccaaattatttttatttttccgtaagctgtacgaca
agaaaaaagagagagaaagaaaaagaaggtgtagattattatttcatagataagactata
tttgaagataaattaaaaaatgaagattttttagaatatgataattatgctaataatttt
tatggaacattaaaaagtgaatatgataaagcaaaagaacaaaataaaatctgcttattt
gaaatgaatattaatggtgtcaaacaattgaaaaaatcaacacatataaaaaatgctctc
tatatatttattaaaccaccaagtactgatgtactcttaagtagattattaacaagaaat
acagaaaatcaagaacaaatacaaaaacgtatggaacaattgaatatcgaattacatgaa
gcaaacttattaaattttaatttatcaattattaatgatgatttaacattaacatatcaa
cagctcaaaaattatttacttaattcatacattcacttgaataatcacacaaggaattaa

DBGET integrated database retrieval system