KEGG   Plasmodium falciparum Dd2: PFDG_03386Help
Entry
PFDG_03386        CDS       T01051                                 

Definition
hypothetical protein
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
pfd  Plasmodium falciparum Dd2
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pfd00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PFDG_03386
Enzymes [BR:pfd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     PFDG_03386
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Structure
PDB: 

Jmol
AA seq 199 aa AA seqDB search
MNNIYPLVICGPSGVGKGTLIKKLLNEFPNYFYFSVSCTTRKKREKEKEGVDYYFIDKTI
FEDKLKNEDFLEYDNYANNFYGTLKSEYDKAKEQNKICLFEMNINGVKQLKKSTHIKNAL
YIFIKPPSTDVLLSRLLTRNTENQEQIQKRMEQLNIELHEANLLNFNLSIINDDLTLTYQ
QLKNYLLNSYIHLNNHTRN
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaataatatttatcccctggttatttgtggtccttcgggtgttggtaaaggtaccttg
ataaaaaagctgttgaatgaatttccaaattatttttatttttccgtaagctgtacgaca
agaaaaaagagagagaaagaaaaagaaggtgtagattattatttcatagataagactata
tttgaagataaattaaaaaatgaagattttttagaatatgataattatgctaataatttt
tatggaacattaaaaagtgaatatgataaagcaaaagaacaaaataaaatctgcttattt
gaaatgaatattaatggtgtcaaacaattgaaaaaatcaacacatataaaaaatgctctc
tatatatttattaaaccaccaagtactgatgtactcttaagtagattattaacaagaaat
acagaaaatcaagaacaaatacaaaaacgtatggaacaattgaatatcgaattacatgaa
gcaaacttattaaattttaatttatcaattattaatgatgatttaacattaacatatcaa
cagctcaaaaattatttacttaattcatacattcacttgaataatcacacaaggaattaa

DBGET integrated database retrieval system