KEGG   Plasmodium falciparum Dd2: PFDG_03615Help
Entry
PFDG_03615        CDS       T01051                                 

Definition
hypothetical protein similar to cGMP-dependent protein kinase
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
pfd  Plasmodium falciparum Dd2
Brite
Enzymes [BR:pfd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     PFDG_03615
Protein kinases [BR:pfd01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   PFDG_03615
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
AA seq 853 aa AA seqDB search
MEEDDNLKKGNERNKKKAIFSNDDFTGEDSLMEDHLELREKLSEDIDMIKTSLKNNLVCS
TLNDNEILTLSNYMQFFVFKSGNLVIKQGEKGSYFFIINSGKFDVYVNDKKVKTMGKGSS
FGEAALIHNTQRSATIIAETDGTLWGVQRSTFRATLKQLSNRNFNENRTFIDSVSVFDML
TEAQKNMITNACVIQNFKSGETIVKQGDYGDVLYILKEGKATVYINDEEIRVLEKGSYFG
ERALLYDEPRSATIIAKEPTACASICRKLLNIVLGNLQVVLFRNIMTEALQQSEIFKQFS
GDQLNDLADTAIVRDYPANYNILHKDKVKSVKYIIVLEGKVELFLDDTSIGILSRGMSFG
DQYVLNQKQPFKHTIKSLEVCKIALITETCLADCLGNNNIDASIDYNNKKSIIKKMYIFR
YLTDKQCNLLIEAFRTTRYEEGDYIIQEGEVGSRFYIIKNGEVEIVKNKKRLRTLGKNDY
FGERALLYDEPRTASVISKVNNVECWFVDKSVFLQIIQGPMLAHLEERIKMQDTKVEMDE
LETERIIGRGTFGTVKLVHHKPTKIRYALKCVSKRSIINLNQQNNIKLEREITAENDHPF
IIRLVRTFKDSKYFYFLTELVTGGELYDAIRKLGLLSKSQAQFYLGSIILAIEYLHERNI
VYRDLKPENILLDKQGYVKLIDFGCAKKVQGRAYTLVGTPHYMAPEVILGKGYGCTVDIW
ALGICLYEFICGPLPFGNDEEDQLEIFRDILTGQLTFPDYVTDTDSINLMKRLLCRLPQG
RIGCSINGFKDIKDHPFFSNFNWDKLAGRLLDPPLVSKSETYAEDIDIKQIEEEDAEDDE
EPLNDEDNWDIDF
NT seq 3572 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagatgataatctaaaaaaagggtaaatttgaaatatgttgaaaaaaaaaaaa
agaaaaaaacatatatataatatatatatatatataataaatttatacctacatttatgt
aattttgtttatatgaaggtaacaaatttattataagattaagaatatttcataatactt
tacaaacttatatgtgcatcatttttttggtttttatttattattattatttttttttta
gttttatatttttaaaaaatataatgtatagaaaatttaattacatgttatggatgttct
atatatttctttttaaaattgctcttgtttactaatgtatgattcttctttttttttttt
ttttttttcttttttaatcatatttttattaggaatgaaagaaataaaaagaaggctata
ttttcaaatgatgattttacaggagaagatagtttaatggaggtaagaaataaaaggaat
ttgtaattttttttttaaattgtatatttaaaagggaataatgtatgtattaatttttgt
gatggtttattatatattatttttaaattacatatccatatttaattatatacaaatgtt
gttttcagaattttttttttttttttttctatttatctataacatatatttaattttatt
tttaggatcatttagaacttcgggaaaagctttcagaagatattgatatgataaagactt
ccttaaaaaataatctagtttgtagtacattaaacgataatgaaatattgactctgtcta
attatatgcaattctttgtttttaaaagtggaaatttagtaataaaacaaggggaaaaag
gtaccaaaataaataaataaataaatatatatatataagtaaataatttcttgttaataa
taaaatatatatccgtctttacataaaatatttaagtaaagtgtatgtcacataaaaata
tttttttttttttttttttttttttttttttttcccccccttttagggtcatactttttc
attattaatagtggcaaatttgacgtttatgtaaatgataaaaaagtaaagactatggga
aaaggtagttctttcggtgaagctgctttaattcataatacccaaagaagtgcaactatt
attgcagaaactgatggaactctatggggagttcaaagaagtacatttagagctacccta
aaacaattatctaatagaaattttaacgaaaacagaacatttatcgattccgtttcagtt
tttgatatgttaactgaagcacaaaaaaacatgattactaatgcttgtgtaatacaaaac
tttaaatctggtgaaaccattgttaaacaaggagattatggagatgtcttatacattttg
aaagaaggaaaggctacagtatatattaacgatgaagagataagggttttagagaaagta
cgcaaaaaaaaaaaataaataaaaaaaataaaaaaaataaaaaaaataaaaaaaataaaa
aaaataaaaaaaaaaaaaaaaaaaaaataaaaaaaaaataaaaaataaaaataaaaaaaa
aaaatgaaacaaaaatgtacatatattctttcattttgtttttttttttatgcataaatg
ttatacgttttattatttttagatattttgatatatatatatatatatatgtatatatgt
ataacacttattattattatttttttttttaacagggttcctattttggggaaagagctc
tactgtatgatgaaccaagaagtgcaacaatcattgcaaaagaaccaaccgcttgtgcat
ccatttgtaggaaattattaaatattgttctaggaaacttacaagtagttttatttcgta
atattatgactgaagctttacaacagagtgaaatttttaaacaatttagtggggatcaat
taaacgatttagcagataccgccattgttcgagattatccagctaattataatatattac
ataaggataaggtaaaatccgttaaatatattattgtattggaaggtaaagtagaattat
ttcttgatgatacttctattggtatattatccagaggaatgtcttttggagatcaatatg
tattaaatcagaaacaaccatttaagcatactattaaatcattagaagtttgtaaaatcg
cattaataacggaaacttgtttagctgattgtctaggaaataataatattgatgcatcta
ttgattataataataaaaaaagtattataaagaaaatgtatatctttagatacttaactg
ataaacaatgtaatttattaattgaagcttttagaaccacaagatatgaagaaggtgatt
atataatacaagaaggagaagtaggatctagattttatataataaaaaatggagaagtag
aaatagtaaaaaataaaaaaaggttacgtaccttaggaaagaatgattactttggtgaaa
gagctttattatatgatgaaccaagaacagcttctgttataagtaaagtaaataatgttg
aatgttggtttgttgataaaagtgtgtttttacaaattatacaaggacctatgttagcac
atttggaagaaagaataaaaatgcaagatactaaagtagaaatggatgaactagaaacag
aacgaattattggaagaggtactttcggaacagttaaattagttcatcataaaccaacaa
aaataagatatgctttaaaatgtgttagtaaaagaagtattattaatttaaatcaacaaa
acaatataaaattagaaagagaaataacagcagaaaatgatcatccatttattataagat
tagtaagaacatttaaagattctaaatatttctattttctaacagaattagtaacaggtg
gagaattatatgatgctattagaaaattaggtttattatctaaatcacaagctcaatttt
atttaggttctatcattttagctattgaatatttacatgaaagaaatattgtatatagag
atttaaaaccagaaaacattttattagataaacaaggttatgtaaaactaatcgattttg
gttgtgccaaaaaggtacaaggtagagcttatacattagtaggtacacctcattatatgg
cacctgaggttattttaggaaaaggttatggatgtactgttgacatatgggcattgggaa
tatgcctatatgaatttatatgtggtccattaccatttggtaatgatgaagaagatcaat
tagaaattttccgtgatatattaaccggccaacttacatttccagattatgtaacagaca
cagatagcataaatttgatgaaaagacttctatgtagattacctcaaggaagaattggtt
gttcaataaatggcttcaaagacataaaggatcacccatttttctcaaactttaattggg
ataaattggctggtcgtttgcttgatccgcctttagtatcaaaaagtgaaacttatgcag
aagatattgatattaaacaaatagaggaggaggatgctgaggatgatgaggaaccattga
acgatgaagacaactgggacatagatttttaa

DBGET integrated database retrieval system