KEGG   Plasmodium falciparum Dd2: PFDG_03651Help
Entry
PFDG_03651        CDS       T01051                                 

Definition
hypothetical protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
pfd  Plasmodium falciparum Dd2
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:pfd01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:pfd01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
AA seq 949 aa AA seqDB search
MIEMILSYVYKSLAGVLHTLNKSYLDIKDIGVTYLTYFIFLISCYLLKNYFSFKFLNFIR
IVKSSIVLIICLISLKYLDLNLTLSINFFYLYNILQLSNFLEVSTSQNKKSNNKSKNVEA
KVINKYELRNENEEKNYELIGDTSKHLEKIAKKILNNKKKLEENECILKEKEIIDEIERK
EKEEEEIMKMKNNLNAKKNKDKRKDKINLYGIYVFFLQTFYIYFFYFFWNYIQNLIIIKI
FLTLQLVKCLISFVSNFWINNMNINLFKRMIHILDIIYMFSISLFFTNILYNISQNTHFL
RNFAVYSIVFHVYYAYVLFVKYIYTYHKQFRSSLFSFILFFHVFGIIGMIKLYYHEYGKS
LLIQCVIFYLINGFGITFGAHRLWSHRAFKAGHIVQVLFLILNSFANQGSVIVWAINHRL
HHKYSDTKYDPHNIRYGFFYSHVGWLLYQKTKYVKEKEKEIYVDDLLQNPYLLLQHKLDP
YFNFFFCFIIPGIYSYFMYNNFWDGFFILGALRWIITLHATWSINSASHSFGHRPYNIDI
KPTNNIFTSIVALGEGCHNYHHVFPYCYAMNENFYILSINPTKYLINFFYYLGLVWDLKC
AKNICKEVRLRETLKLEKRNKALSENIKNEIMKKEDTSYVIELMNSFKALCNDYLNISTF
MYILYFLRDIVIMITIFLIHICYCYNKYGNGTMFSTISQKFNIENNKYISISLSFFFHII
LYTLPMGTMFASLYALVYECKRELLFKKPLFNHFFGSIISSFILLPYTSEKNRKSVLTAL
NEDFVKILKGPIYFDIYSLIFTFFSVFYIMTYYIFGYFYFCTFFLGPYIVFNAWLLIYIY
LLKNPPFLQMDINTKEVDIGVLNYVAFQSLLQWKKNNSIYQSKKRLYKMVFSFINFIHHH
LCYTHVVEFINASIPSYRTKEIYKHFDKTLDQYNFLRNDKFMDVLKEFL
NT seq 3002 nt NT seq  +upstreamnt  +downstreamnt
atgatagaaatgatcttaagttatgtatataaatcgttagcaggtgtattgcacacgtta
aacaaaagttatttagacattaaagacataggtgtaacctatttaacctattttattttt
ttaatttcatgttatttattaaagaattatttttcatttaagtttcttaattttataaga
attgtaaaaagttccatagttctaataatatgtttaataagtttaaaatatttagatttg
aacctgaccttaagtattaactttttttatttatacaacattttacagttaagtaacttt
ttagaagtaagtacatcacaaaataaaaaaagcaataacaaatcaaaaaatgtagaggca
aaagtaattaataaatatgaattaagaaatgaaaatgaagaaaaaaattatgagttaatt
ggagatacatcaaaacatttagaaaaaattgcaaaaaaaatattaaataataaaaaaaaa
ttagaagaaaatgaatgcatattaaaagaaaaagaaattattgatgaaatagaaagaaaa
gaaaaagaagaagaagaaattatgaaaatgaaaaataatcttaatgctaaaaaaaataaa
gataaaagaaaggacaaaataaatttatatggtatttatgttttctttttacaaaccttt
tatatatattttttttatttcttttggaattatattcagaacttgattattataaaaata
ttcttaactttacaattagttaaatgtctcatttcttttgttagtaatttctggataaat
aatatgaatataaatttattcaaaagaatgatacatatattagacatcatatatatgttt
tctataagtttattttttacaaatattctgtacaatatatcacaaaatacacatttctta
cgtaactttgcagtatactctattgtatttcatgtatattatgcatatgtcctatttgtt
aagtatatatacacatatcataagcagtttagatcatctttattttcttttattttgttc
ttccacgtatttggaataattggaatgataaaattatattatcacgagtatggaaagtca
ttattaattcaggtaacctcatataaaatatatgaacaataaaaaaaaaaaatctatata
tatatatatatatatatatatgtatatatgattatgtacatatacacctatatacaattt
atatacatgtatttctttatatatatatatatttttttttttagtgcgtaatattttacc
tcataaacggtttcggaataacatttggagctcatcggttatggtcacatagggcattta
aagctggtcacattgttcaggttttatttttaattttgaatagttttgctaatcaaggga
gtgtaatagtttgggccataaatcatcgtttacatcataaatacagtgatacaaaatatg
atcctcataatataagatatggcttcttttatagtcacgttggatggcttttatatcaga
aaacgaaatatgtaaaagaaaaagagaaagaaatttatgtagatgatttattacaaaatc
cttatcttctcttacaacacaaattagatccatattttaattttttcttttgttttatta
tacctggtatatattcatattttatgtataataatttttgggatggattttttatattag
gagctcttcgttggattattactttacatgctacatggtctattaatagtgcatcacatt
cttttggacatagaccctataatattgatataaaaccaaccaataatatttttacatcta
tagtagcccttggagaaggatgtcataattatcatcatgtgtttccttactgttatgcca
tgaatgaaaatttttatattcttagtataaaccctacgaaatatctgataaattttttct
attatttaggtttagtatgggatttaaaatgtgcaaagaatatttgtaaagaagtacgat
taagagaaacattaaaattagaaaagagaaataaagcattaagtgaaaacattaaaaatg
aaataatgaaaaaagaagatacaagttatgttatagaattaatgaattctttcaaagcat
tgtgtaatgattatttaaatatttcaacctttatgtacattttatacttcttaagagata
ttgtaattatgattactatatttttaattcacatatgttactgttataataaatatggaa
atggtacgatgttttctacaatatcacaaaaatttaatatagaaaataataaatatatat
caatatcactttcctttttctttcatattattttatatacactacccatgggaactatgt
ttgcaagtttatatgcattagtttatgaatgtaaaagagagctactttttaaaaaaccac
tatttaatcatttctttggtagtattatttcatcatttattttgttaccatatacttcag
agaaaaatagaaaatcagtattaacagcgttgaatgaagatttcgttaaaattttaaagg
ggccaatatattttgacatatattctttaatatttacctttttttcagtattctatataa
tgacatattatatatttgggtacttttatttctgtacattttttttaggaccatatattg
tttttaatgcatggttattaatttatatatatttattaaaaaatcctccatttttacaaa
tggatattaatactaaagaagtggatattggtgttttaaattatgttgctttccaatcat
tacttcaatggaaaaaaaataattcaatatatcaaagtaaaaagaggttatataaaatgg
ttttttcatttataaatttcatacatcatcacttatgttatactcatgttgttgaattca
ttaatgctagcataccaagttacagaactaaagaaatatataaacattttgataaaacct
tagatcagtataatttcctacgcaatgacaaatttatggacgtactaaaggaattcttat
ga

DBGET integrated database retrieval system