KEGG   Plasmodium falciparum Dd2: PFDG_03651Help
Entry
PFDG_03651        CDS       T01051                                 

Definition
hypothetical protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
pfd  Plasmodium falciparum Dd2
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:pfd00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    PFDG_03651
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PFDG_03651
Enzymes [BR:pfd01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     PFDG_03651
Lipid biosynthesis proteins [BR:pfd01004]
 Desaturase
  First
   PFDG_03651
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
AA seq 949 aa AA seqDB search
MIEMILSYVYKSLAGVLHTLNKSYLDIKDIGVTYLTYFIFLISCYLLKNYFSFKFLNFIR
IVKSSIVLIICLISLKYLDLNLTLSINFFYLYNILQLSNFLEVSTSQNKKSNNKSKNVEA
KVINKYELRNENEEKNYELIGDTSKHLEKIAKKILNNKKKLEENECILKEKEIIDEIERK
EKEEEEIMKMKNNLNAKKNKDKRKDKINLYGIYVFFLQTFYIYFFYFFWNYIQNLIIIKI
FLTLQLVKCLISFVSNFWINNMNINLFKRMIHILDIIYMFSISLFFTNILYNISQNTHFL
RNFAVYSIVFHVYYAYVLFVKYIYTYHKQFRSSLFSFILFFHVFGIIGMIKLYYHEYGKS
LLIQCVIFYLINGFGITFGAHRLWSHRAFKAGHIVQVLFLILNSFANQGSVIVWAINHRL
HHKYSDTKYDPHNIRYGFFYSHVGWLLYQKTKYVKEKEKEIYVDDLLQNPYLLLQHKLDP
YFNFFFCFIIPGIYSYFMYNNFWDGFFILGALRWIITLHATWSINSASHSFGHRPYNIDI
KPTNNIFTSIVALGEGCHNYHHVFPYCYAMNENFYILSINPTKYLINFFYYLGLVWDLKC
AKNICKEVRLRETLKLEKRNKALSENIKNEIMKKEDTSYVIELMNSFKALCNDYLNISTF
MYILYFLRDIVIMITIFLIHICYCYNKYGNGTMFSTISQKFNIENNKYISISLSFFFHII
LYTLPMGTMFASLYALVYECKRELLFKKPLFNHFFGSIISSFILLPYTSEKNRKSVLTAL
NEDFVKILKGPIYFDIYSLIFTFFSVFYIMTYYIFGYFYFCTFFLGPYIVFNAWLLIYIY
LLKNPPFLQMDINTKEVDIGVLNYVAFQSLLQWKKNNSIYQSKKRLYKMVFSFINFIHHH
LCYTHVVEFINASIPSYRTKEIYKHFDKTLDQYNFLRNDKFMDVLKEFL
NT seq 3002 nt NT seq  +upstreamnt  +downstreamnt
atgatagaaatgatcttaagttatgtatataaatcgttagcaggtgtattgcacacgtta
aacaaaagttatttagacattaaagacataggtgtaacctatttaacctattttattttt
ttaatttcatgttatttattaaagaattatttttcatttaagtttcttaattttataaga
attgtaaaaagttccatagttctaataatatgtttaataagtttaaaatatttagatttg
aacctgaccttaagtattaactttttttatttatacaacattttacagttaagtaacttt
ttagaagtaagtacatcacaaaataaaaaaagcaataacaaatcaaaaaatgtagaggca
aaagtaattaataaatatgaattaagaaatgaaaatgaagaaaaaaattatgagttaatt
ggagatacatcaaaacatttagaaaaaattgcaaaaaaaatattaaataataaaaaaaaa
ttagaagaaaatgaatgcatattaaaagaaaaagaaattattgatgaaatagaaagaaaa
gaaaaagaagaagaagaaattatgaaaatgaaaaataatcttaatgctaaaaaaaataaa
gataaaagaaaggacaaaataaatttatatggtatttatgttttctttttacaaaccttt
tatatatattttttttatttcttttggaattatattcagaacttgattattataaaaata
ttcttaactttacaattagttaaatgtctcatttcttttgttagtaatttctggataaat
aatatgaatataaatttattcaaaagaatgatacatatattagacatcatatatatgttt
tctataagtttattttttacaaatattctgtacaatatatcacaaaatacacatttctta
cgtaactttgcagtatactctattgtatttcatgtatattatgcatatgtcctatttgtt
aagtatatatacacatatcataagcagtttagatcatctttattttcttttattttgttc
ttccacgtatttggaataattggaatgataaaattatattatcacgagtatggaaagtca
ttattaattcaggtaacctcatataaaatatatgaacaataaaaaaaaaaaatctatata
tatatatatatatatatatatgtatatatgattatgtacatatacacctatatacaattt
atatacatgtatttctttatatatatatatatttttttttttagtgcgtaatattttacc
tcataaacggtttcggaataacatttggagctcatcggttatggtcacatagggcattta
aagctggtcacattgttcaggttttatttttaattttgaatagttttgctaatcaaggga
gtgtaatagtttgggccataaatcatcgtttacatcataaatacagtgatacaaaatatg
atcctcataatataagatatggcttcttttatagtcacgttggatggcttttatatcaga
aaacgaaatatgtaaaagaaaaagagaaagaaatttatgtagatgatttattacaaaatc
cttatcttctcttacaacacaaattagatccatattttaattttttcttttgttttatta
tacctggtatatattcatattttatgtataataatttttgggatggattttttatattag
gagctcttcgttggattattactttacatgctacatggtctattaatagtgcatcacatt
cttttggacatagaccctataatattgatataaaaccaaccaataatatttttacatcta
tagtagcccttggagaaggatgtcataattatcatcatgtgtttccttactgttatgcca
tgaatgaaaatttttatattcttagtataaaccctacgaaatatctgataaattttttct
attatttaggtttagtatgggatttaaaatgtgcaaagaatatttgtaaagaagtacgat
taagagaaacattaaaattagaaaagagaaataaagcattaagtgaaaacattaaaaatg
aaataatgaaaaaagaagatacaagttatgttatagaattaatgaattctttcaaagcat
tgtgtaatgattatttaaatatttcaacctttatgtacattttatacttcttaagagata
ttgtaattatgattactatatttttaattcacatatgttactgttataataaatatggaa
atggtacgatgttttctacaatatcacaaaaatttaatatagaaaataataaatatatat
caatatcactttcctttttctttcatattattttatatacactacccatgggaactatgt
ttgcaagtttatatgcattagtttatgaatgtaaaagagagctactttttaaaaaaccac
tatttaatcatttctttggtagtattatttcatcatttattttgttaccatatacttcag
agaaaaatagaaaatcagtattaacagcgttgaatgaagatttcgttaaaattttaaagg
ggccaatatattttgacatatattctttaatatttacctttttttcagtattctatataa
tgacatattatatatttgggtacttttatttctgtacattttttttaggaccatatattg
tttttaatgcatggttattaatttatatatatttattaaaaaatcctccatttttacaaa
tggatattaatactaaagaagtggatattggtgttttaaattatgttgctttccaatcat
tacttcaatggaaaaaaaataattcaatatatcaaagtaaaaagaggttatataaaatgg
ttttttcatttataaatttcatacatcatcacttatgttatactcatgttgttgaattca
ttaatgctagcataccaagttacagaactaaagaaatatataaacattttgataaaacct
tagatcagtataatttcctacgcaatgacaaatttatggacgtactaaaggaattcttat
ga

DBGET integrated database retrieval system