KEGG   Plasmodium falciparum Dd2: PFDG_03695Help
Entry
PFDG_03695        CDS       T01051                                 

Definition
hypothetical protein
Orthology
K08738  
cytochrome c
Organism
pfd  Plasmodium falciparum Dd2
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfd00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    PFDG_03695
BRITE hierarchy
SSDB OrthologParalogGFIT
AA seq 66 aa AA seqDB search
MSKGNSPFQTSPDLYTSGIIWNDVNLLKYMKNPQQFVESHIGMTFKGLSNLQERGRYCTL
LKNIDL
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
ggtggttataaaaaaaaaaggcaattagatgatgaatttcccgatgatttcgtattacct
cctggtgataaagtaaaaggagagaaattatttaaaaagcattgtaagcagtgtcattcg
atagcacctgataatagtcagactaattcaggatttacgagttggggacctacattattt
aatgtatataatagaacagcaggaatgagtaaaggtaattcacctttccaaacatctccc
gatttatatacatcaggaataatatggaatgatgtgaatttacttaagtatatgaaaaat
ccacaacaatttgttgagtcacatattggtatgacttttaagggtttatcgaatttgcaa
gaaaggggtcgatattgtacattacttaaaaacattgacttatga

DBGET integrated database retrieval system