KEGG   Plasmodium falciparum Dd2: PFDG_04158Help
Entry
PFDG_04158        CDS       T01051                                 

Definition
hypothetical protein
Orthology
K13998  
dihydrofolate reductase / thymidylate synthase [EC:1.5.1.3 2.1.1.45]
Organism
pfd  Plasmodium falciparum Dd2
Pathway
Pyrimidine metabolism
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfd00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PFDG_04158
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PFDG_04158
   00670 One carbon pool by folate
    PFDG_04158
Enzymes [BR:pfd01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     PFDG_04158
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.45  thymidylate synthase
     PFDG_04158
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Structure
PDB: 

Jmol
AA seq 608 aa AA seqDB search
MMEQVCDVFDIYAICACCKVESKNEGKKNEVFNNYTFRGLGNKGVLPWKCISLDMKYFRA
VTTYVNESKYEKLKYKRCKYLNKETVDNVNDMPNSKKLQNVVVMGRTNWESIPKKFKPLS
NRINVILSRTLKKEDFDEDVYIINKVEDLIVLLGKLNYYKCFIIGGSVVYQEFLEKKLIK
KIYFTRINSTYECDVFFPEINENEYQIISVSDVYTSNNTTLDFIIYKKTNNKMLNEQNCI
KGEEKNNDMPLKNDDKDTCHMKKLTEFYKNVDKYKINYENDDDDEEEDDFVYFNFNKEKE
EKNKNSIHPNDFQIYNSLKYKYHPEYQYLNIIYDIMMNGNKQSDRTGVGVLSKFGYIMKF
DLSQYFPLLTTKKLFLRGIIEELLWFIRGETNGNTLLNKNVRIWEANGTREFLDNRKLFH
REVNDLGPIYGFQWRHFGAEYTNMYDNYENKGVDQLKNIINLIKNDPTSRRILLCAWNVK
DLDQMALPPCHILCQFYVFDGKLSCIMYQRSCDLGLGVPFNIASYSIFTHMIAQVCNLQP
AQFIHVLGNAHVYNNHIDSLKIQLNRIPYPFPTLKLNPDIKNIEDFTISDFTIQNYVHHE
KISMDMAA
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgatggaacaagtctgcgacgttttcgatatttatgccatatgtgcatgttgtaaggtt
gaaagcaaaaatgaggggaaaaaaaatgaggtttttaataactacacatttagaggtcta
ggaaataaaggagtattaccatggaaatgtatttccctagatatgaaatattttcgtgca
gttacaacatatgtgaatgaatcaaaatatgaaaaattgaaatataagagatgtaaatat
ttaaacaaagaaactgtggataatgtaaatgatatgcctaattctaaaaaattacaaaat
gttgtagttatgggaagaacaaactgggaaagcattccaaaaaaatttaaacctttaagc
aataggataaatgttatattgtctagaaccttaaaaaaagaagattttgatgaagatgtt
tatatcattaacaaagttgaagatctaatagttttacttgggaaattaaattactataaa
tgttttattataggaggttccgttgtttatcaagaatttttagaaaagaaattaataaaa
aaaatatattttactagaataaatagtacatatgaatgtgatgtattttttccagaaata
aatgaaaatgagtatcaaattatttctgttagcgatgtatatactagtaacaatacaaca
ttggattttatcatttataagaaaacgaataataaaatgttaaatgaacaaaattgtata
aaaggagaagaaaaaaataatgatatgcctttaaagaatgatgacaaagatacatgtcat
atgaaaaaattaacagaattttacaaaaatgtagacaaatataaaattaattatgaaaat
gatgatgatgatgaagaagaagatgattttgtttattttaattttaataaagaaaaagaa
gagaaaaataaaaattctatacatccaaatgattttcaaatatataatagcttgaaatat
aaatatcatcctgaataccaatatttaaatattatttatgatattatgatgaatggaaat
aaacaaagtgatcgaacgggagtaggtgttttaagtaaattcggatatattatgaaattt
gatttaagtcaatatttcccattattaactacgaagaaattatttttaagaggaattatt
gaagaattgctttggtttattagaggagaaacaaatggtaatacgttgttaaataagaat
gtaaggatatgggaagctaatggtactagggaatttttagataatagaaaattatttcat
agagaagttaacgatttaggacctatttatggttttcaatggagacatttcggtgctgaa
tatacaaatatgtatgataattatgaaaataaaggagtggatcaattaaaaaatataata
aatttaattaaaaatgatcctacaagtagaagaattcttttgtgtgcatggaatgtaaaa
gatcttgaccaaatggcattacctccttgtcatattttatgtcagttttatgttttcgat
gggaaattatcatgtattatgtatcaaagatcatgtgatttagggctaggagtacctttt
aatattgcttcttattctatttttactcatatgattgcacaagtctgtaatttgcaacct
gcgcagttcatacacgttttaggaaatgcacatgtttataataatcacattgatagttta
aaaattcaacttaacagaataccctatccattcccaacacttaaattaaatccagatatt
aaaaatattgaagattttacaatttcggattttacaatacaaaattatgttcatcatgaa
aaaatttcaatggatatggctgcttaa

DBGET integrated database retrieval system