KEGG   Plasmodium falciparum Dd2: PFDG_04401Help
Entry
PFDG_04401        CDS       T01051                                 

Definition
hypothetical protein
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
pfd  Plasmodium falciparum Dd2
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pfd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PFDG_04401
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PFDG_04401
Enzymes [BR:pfd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     PFDG_04401
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
AA seq 419 aa AA seqDB search
MLDTIESYIKSHKEKENLYVKKNVSIIGSPLAAGQPLGGVQLACDDLRKLGLHNVIDVLG
WKYEDIGNIDNGDNEMKQEKKTNNYINNNDNNNDNNNDNNNDNNNDNNNDNNNNCYIPNG
VIKEKKHDLSNNKMNGYVNHNFYGNYEENNVISTNDKYKNNCYYDNIRNIKEIGIFSKNL
FDTMSNELRKKNFVLNIGGDHGVAFSSILSSLQMYQNLRVIWIDAHGDINIPETSPSGNY
HGMTLAHTLGLFKKKVPYFEWSEKLTYLKPENTAIIGIRDIDAYEKIILKKCNINYYTIF
DIEKNGIYNTICTALEKIDPNSNCPIHISLDIDSVDNVFAPGTGTVAKGGLNYREINLLM
KILAETKRVVSMDLVEYNPSLDEVDKKVHGDSLPILDNATKTGKLCLELIARVLGYDIV
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgttggatactatagaaagttacatcaaaagtcacaaggaaaaggaaaacctttatgtt
aagaaaaacgtttccattattggttctcctcttgccgctggtcaacctcttggaggggtg
caattagcatgtgatgacttgagaaaattaggtttgcacaatgttatagatgtgttagga
tggaaatatgaagatataggcaatatagataatggggataatgaaatgaaacaagaaaaa
aaaactaataattatattaataataatgataataataatgataacaataatgataataat
aatgataataataatgataacaataatgataataataataattgttatattcccaatggt
gtaattaaagaaaagaaacatgatttgtcaaataataaaatgaatggatatgtgaaccat
aatttttatggtaattatgaagagaataatgtaatatcaacaaacgataaatataaaaat
aattgttattatgataatataaggaatataaaagaaataggtatattcagtaaaaattta
tttgatactatgagcaatgaattaaggaagaaaaattttgtattaaatatagggggtgac
catggtgtagcttttagtagtatcctgagttccttacaaatgtatcagaatttaagagtt
atatggattgatgcacatggtgatataaacatacctgaaacatctccttcaggtaattat
catggtatgactttagcacacaccttagggttatttaaaaagaaagttccttattttgaa
tggtccgaaaaattaacatatttaaaaccagaaaatacagctattataggtattagagat
atagatgcatatgaaaaaattattttaaaaaaatgtaatattaattattataccattttt
gatatagaaaaaaatggaatctataatacaatatgtacagcattagaaaaaatagatcca
aattcaaattgccctattcacatctctttagatatagatagtgttgataatgtctttgct
ccaggaactggtactgtagctaaggggggattaaattatagagaaattaatttattaatg
aaaatattagctgaaacaaaaagagttgtctctatggatttagtagaatataatccatca
cttgatgaagttgataaaaaagttcatggagattcattgcctatattggataatgcaacg
aaaacaggcaagttgtgtttagaacttatcgcccgagtgttaggatacgatatagtgtaa

DBGET integrated database retrieval system