KEGG   Pseudomonas fluorescens F113: PSF113_0042Help
Entry
PSF113_0042       CDS       T01734                                 

Definition
diguanylate cyclase (EC:3.5.1.28)
Orthology
K13590  
diguanylate cyclase
Organism
pfe  Pseudomonas fluorescens F113
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
44423..46510
Genome map
AA seq 695 aa AA seqDB search
MSDDAERWREKYLKSIEQQEKLERRWDARLDLLRRGLVRSTLAAEGTDRAVDQCMKEMRE
VVRTDDMDAGLAALLPRLEKAVLDSEQRRETRVEQTSAALTALVAQLQSLPLPKEVSRSL
KKFAKQLEDRANQSREIPLLLSELSGLQGKALSALDAPVEPNRPGLLQRLFGGQGHEEAT
PQPHEPVQAGVAPASETALPVAVEPATDAESVAPAPAPAPAPAPAPAPAPQPSVAEQAPT
LEMTPEPVAMTAPKIEPDPTPAPTLVAEVVQPISEPDEATEPAPLQVLVADELPVAAPPL
ENPDELMPEEPAQALPDPSLPPAEPAEPLEAIDVADAQYALPDSPEPSYSSVAKHIEDTL
LGLLGDLTLPERHRPQAEAMRERLRNGLNWYELLPILDDLAVLMLAITDTGQHEFEAYLQ
RLNDRLESFQSSLQAASEDHADNLSASREMDTQIREQVDGLQSSVQEADDLEGLKQVLEN
HLEGLLGTMDQHRQQRDQREQEVSARLKSLADRVALMEQDAQVVRENLEEQRQKALVDPL
TGLPNRAAWSERLEHEVVQWQRHGNSLLLAMLDLDHFKRINDNYGHLAGDRVLKLIASVL
RKRLRGGDFIARFGGEEFILLVPDTPLAAGAKLAEALRLAIEACPFHFKGEPVTVTVSIG
LTAFKPGEHSDSVLKRADQALYRAKNAGRNRIELG
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgacgccgaacgctggagagagaagtacctcaagagtatcgaacagcaggaa
aagctcgagcgtcgctgggatgctcggctcgacttgctgcgtcgtggcctggtgcgcagc
accctggccgccgagggcactgaccgggctgtcgatcaatgcatgaaagagatgcgcgag
gtggtgcgcaccgatgacatggatgctggcctcgccgccctgctgccgcgcctggagaaa
gccgtactcgattccgagcagcgtcgcgaaacccgggtcgagcagacgagcgccgcgttg
acggccctggttgcccagttgcagagcctgccgctgcccaaagaagtcagccggtcgctg
aagaagttcgccaagcaactggaggatcgggccaaccagtcccgggagattccactgttg
ctcagcgaattgagcggtttgcaaggcaaggcactgagtgccctggacgcccctgtcgaa
ccgaatcgccccggcctgttgcaacggctgttcggcggccaaggccatgaggaagcgacg
ccccagccccacgaacctgtccaggccggcgtggcgcctgcctcagaaacggccctgccc
gtagcggtggagccggcaacggacgcagaatctgtcgcaccagcaccagcaccagcacca
gcaccagcaccagcaccagcaccagcaccgcagccatcggtcgcggagcaagcaccaacg
ttggagatgacgcccgaaccggttgccatgactgcgccgaagatcgagccagacccgacg
cccgctccaacacttgttgccgaagtggttcaaccgatcagcgaaccggacgaagccacc
gagcccgcgccgctgcaagtcttggtcgcggacgaactcccggtagcggcacccccgctc
gagaatcccgacgaactgatgcccgaggagcctgcacaggccctgcccgatccctcgctg
cccccagcggagcccgccgagcctctggaagccatcgatgtggctgacgcccagtacgcc
ctgcccgactcgccggagccgtcgtacagctcggtcgccaagcatatcgaagacacgttg
ttgggcctgttgggtgacctgaccttgcccgagcgccatcggccacaagccgaagccatg
cgtgagcggttgcgaaatggcttgaactggtatgaattgctgccgatcctcgatgatctg
gcggtactgatgttggccatcaccgacaccggccagcatgagtttgaagcgtacctgcag
cgcctcaacgatcggcttgagtcattccagagcagcctgcaggccgccagtgaagaccac
gccgacaacctgtcggcctcccgggaaatggacacccagattcgcgaacaggtggacggc
ctgcaaagcagcgtgcaagaagccgatgacctggaaggcctcaagcaggtgctcgagaat
catctcgaaggcttgctcggcacgatggaccaacaccgccagcaacgtgatcaacgcgag
caggaagtctcggctcgcctgaaaagcctggccgatcgcgtcgcgctgatggagcaggac
gcccaggtcgtgcgggagaacctcgaggagcagcggcaaaaagcgttggtcgatcccctc
accgggctgcccaaccgcgccgcctggtccgaacgcctcgagcatgaagtcgttcagtgg
caacggcacggcaacagcttgctgctggccatgctcgatctcgatcatttcaagcgcatc
aatgacaactacggccatctggccggtgaccgggtgttgaaactgatcgcctcggtcctg
cgtaaacgcctgcgtggcggcgatttcattgcgcgttttggcggcgaggaattcatcctg
ctggtgcccgatacgcccctggctgccggcgccaagctggccgaagcgctgcgcctggcc
attgaagcctgtccgttccatttcaagggcgagccggtgacggtgacggtatccattggc
ctgacggcattcaaaccgggcgaacacagcgattcggtgcttaaaagagccgatcaggcg
ctttaccgcgcgaaaaatgccgggcgcaaccgcatagaattgggctga

DBGET integrated database retrieval system