KEGG   Pseudomonas fluorescens F113: PSF113_0139Help
Entry
PSF113_0139       CDS       T01734                                 

Gene name
trpB
Definition
(GenBank) TrpB (EC:4.1.3.- 4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pfe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PSF113_0139 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PSF113_0139 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PSF113_0139 (trpB)
Enzymes [BR:pfe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PSF113_0139 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
150568..151800
Genome map
AA seq 410 aa AA seqDB search
MTQSTTPFNLRSGPDANGLFGAFGGRYVAETLMPLILDLAREYEVAKEDPAFLEELAYFQ
RDYVGRPSPLYFAERLTEYCGGAKIYLKREELNHTGAHKINNCIGQILLARRMGKKRIIA
ETGAGMHGVATATVAARFGLDCVIYMGTTDIERQQANVFRMKLLGAEVIPVVAGTGTLKD
AMNEALRDWVTNVDSTFYLIGTVAGPHPYPAMVRDFQAVIGKETREQLQAQEGRLPDSLV
ACIGGGSNAMGLFHPFLDDKSVEIIGVEAAGYGIETGKHAASLNGGVPGVLHGNRTFLLQ
DDDGQIIDAHSISAGLDYPGIGPEHAWLHDIGRVQYTSVTDAEALEAFHKCCRLEGIIPA
LESAHALAEVFKRAPNLPKDHLMVVNLSGRGDKDMQTVMHHMEQSQQEKH
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgacccagtccacgacccctttcaacctgcgcagcggtcccgatgccaacggcctgttc
ggtgcgttcggtggccgctatgtggccgaaaccctgatgccactgatcctcgatctggcc
cgcgaatacgaagtggcgaaggaagatccggcgttcctcgaagaattggcctacttccag
cgcgattacgtcggtcgtccgagtccgctctacttcgccgagcgcctgaccgaatactgt
ggcggtgccaagatctatctcaagcgtgaagagctgaaccacaccggcgcgcacaagatc
aacaactgcatcggccagatcctgctggcgcggcgcatgggcaaaaaacgcatcatcgcc
gagaccggcgccggcatgcacggtgtggccaccgccactgtggccgcgcgttttggcctc
gattgcgtgatctacatgggcaccaccgacatcgagcgccagcaggccaacgtgttccgc
atgaagctgctgggcgctgaagtgatcccggtggtcgctggcaccggtaccttgaaagat
gcaatgaacgaggccctgcgtgactgggtcaccaacgttgatagcacgttctacctgatc
ggtaccgtggctggcccgcatccgtatccggcgatggtgcgtgacttccaggctgtgatc
ggtaaggaaacccgcgagcagttgcaagcccaggaaggccgcctgccggacagcctggtg
gcgtgcatcggcggcggctccaacgccatgggcctgttccacccgttcctggacgacaag
agtgtcgagatcatcggcgtcgaagccgccggttatggcatcgagaccggtaagcatgcg
gcgagcctgaacggtggcgtccccggtgtactgcacggcaatcgcaccttcctgttgcag
gacgacgacggtcagatcatcgacgcccattcgatttccgccggtctcgactaccccggc
atcggtccggaacatgcctggttgcacgacattggtcgcgtccagtacacctcggtgacc
gacgctgaagccttggaagcctttcacaaatgctgccgactggaagggatcattcctgca
ctggaaagcgcccatgccctggcggaagtgttcaaacgcgcaccgaacctgccgaaggat
cacctgatggtggtcaacctgtccggccgtggcgacaaagacatgcaaaccgtgatgcac
cacatggaacagtcccagcaggagaaacactga

DBGET integrated database retrieval system