KEGG   Pseudomonas fluorescens F113: PSF113_0177Help
Entry
PSF113_0177       CDS       T01734                                 

Gene name
gabT
Definition
GabT protein (EC:1.2.1.16 2.6.1.19 2.6.1.22)
Orthology
K14268  
5-aminovalerate/4-aminobutyrate aminotransferase [EC:2.6.1.48 2.6.1.19]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
Alanine, aspartate and glutamate metabolism
Lysine degradation
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfe00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    PSF113_0177 (gabT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PSF113_0177 (gabT)
   00310 Lysine degradation
    PSF113_0177 (gabT)
Enzymes [BR:pfe01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     PSF113_0177 (gabT)
    2.6.1.48  5-aminovalerate transaminase
     PSF113_0177 (gabT)
Amino acid related enzymes [BR:pfe01007]
 Aminotransferase (transaminase)
  Class III
   PSF113_0177 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
192380..193657
Genome map
AA seq 425 aa AA seqDB search
MSKTNADLMARRIAAVPRGVGQIHPIFAESAKNATVTDVEGREFIDFAGGIAVLNTGHVH
PKIIAAVTAQLNKLTHTCFQVLAYEPYVELCEKINAKVPGDFAKKTLLVTTGSEAVENAV
KIARAATGRAGVIAFTGAYHGRTMMTLGLTGKVVPYSAGMGLMPGGIFRALYPNELHGVS
IDDSIASIERIFKNDAEPRDIAAIIIEPVQGEGGFYVAPKEFMKRLRALCDQHGILLIAD
EVQTGAGRTGTFFAMEQMGVAADLTTFAKSIAGGFPLAGVCGKAEYMDAIAPGGLGGTYA
GSPIACAAALAVMEVFEEEHLLDRCKAVGERLVTGLKAIQKKYPVIGEVRALGAMIALEL
FENGDTHKPNAAAVAQVVAKARDKGLILLSCGTYGNVLRVLVPLTAPDEQLDKGLAILEE
CFSEL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagactaacgctgacttgatggcccgccgtatcgccgctgttccacgcggtgtt
ggccagattcacccgatttttgccgaatcggcgaagaacgccacggtaaccgacgttgaa
ggtcgtgaatttatcgacttcgccggcggcatcgccgtgctgaacaccggtcacgtgcac
ccgaaaatcatcgctgccgtgaccgcacagctgaacaagctgacccacacctgcttccag
gtcctggcctacgagccgtacgtggaactgtgcgaaaaaatcaacgccaaggtgccgggt
gatttcgccaagaaaaccctgctggtgaccaccggttcggaagcggtggaaaacgccgtg
aaaatcgcccgcgccgccacgggccgtgccggtgtgatcgccttcaccggcgcttaccac
ggtcgcaccatgatgaccctgggcctgaccggtaaagtcgtgccgtactcggccggcatg
ggcttgatgcccggcggcatcttccgcgcgctgtacccgaacgaactgcacggcgtgagc
atcgacgactccatcgccagcatcgagcgtatcttcaagaacgacgccgagccgcgtgac
atcgcggcaatcatcatcgagccggtacagggcgagggtggtttctatgtagcgcctaag
gagttcatgaagcgcctgcgcgctttgtgcgaccagcacggcattctgttgatcgctgac
gaagtgcagaccggtgccggccgtaccgggaccttcttcgccatggagcagatgggcgtt
gccgccgacctgaccaccttcgccaaatccatcgctggcggcttcccgttggccggtgtg
tgcggcaaggccgagtacatggatgccatcgcgccgggtggcctgggtggcacctacgcc
ggtagcccgatcgcctgtgcggcggcgctggcggtgatggaagtgtttgaagaagaacac
ctgctggaccgctgcaaggctgtgggcgagcgtctggtgaccggcctcaaggcgatccag
aagaagtacccggtcatcggtgaagtgcgtgccctgggcgcgatgatcgccttggagctg
ttcgaaaacggcgacacccacaagccgaatgcggcagcggtagcccaagtcgtggccaag
gcgcgcgacaagggtctgatcctgctgtcctgcggcacctatggcaacgttctgcgggtg
ctggtgccgctgaccgcgccggacgagcaactggacaaaggcctggcgatcctcgaagag
tgcttctccgaactctga

DBGET integrated database retrieval system