KEGG   Pseudomonas fluorescens F113: PSF113_0270Help
Entry
PSF113_0270       CDS       T01734                                 

Gene name
dcyD
Definition
protein DcyD (EC:4.4.1.15)
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:pfe00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(324993..325991)
Genome map
AA seq 332 aa AA seqDB search
MIKQQLSRFNRLDLLGHPTPLEKLDRLSTWLGRDIYIKRDDLTPLALGGNKLRKLEYLAA
DAIAQGADTLITAGAIQSNHVRQTAALAAKLGLGCVALLENPIGTEDSNYLGNGNRLLLE
LFDAKVELVDNLDNADEQLQALAGRLRSNGKKPYLVPIGGSNALGALGYVRAGLELAEQI
KDTGIEFAAVVLASGSAGTHSGLALALSETLPALPVIGVTVSRSEEDQFPKVQGLAERTA
ALLEVALPEAFKVNLWDEYFAPRYGEPNAGTLAAVKLLASQEGLLLDPVYTGKAMAGLLD
GMGRDRFDEGPIIFLHTGGAPALFAYSAAFPA
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaacaacagctgtctcgctttaaccgtctcgacctgctcggccatccgacaccg
ctggaaaaactcgaccgcctctccacctggctcggccgggacatctatatcaagcgtgac
gacctgacgcccctggccttgggcggcaacaaactgcgcaagctcgaatacctggccgcc
gatgccatcgcccaaggcgccgataccctcatcaccgccggggcgatccagtccaaccat
gtacgccagaccgctgccctcgccgcaaagctgggcctgggctgcgtggccttgctggaa
aaccctatcggcaccgaagacagcaattacctgggcaacggcaaccggctgctgctggaa
ttgttcgacgccaaggtcgagctggtggacaacctggacaacgccgatgagcagctacag
gccctggccggtcgcctgcgcagcaacgggaaaaaaccctacctggtaccgattgggggt
tcgaacgccttgggcgcactgggttatgtgcgcgctggcctggaactggccgagcagatc
aaggacaccgggattgagttcgccgccgtggtactggcctcgggcagtgccgggacccat
agtggcctggcgctggcgctgagtgaaactctgccggcgctgcctgtcatcggcgtgacg
gtttcgcgcagcgaggaggaccagtttccgaaggtccagggcctggccgagcgcacggca
gcgttgctcgaagtcgcccttccagaggcgttcaaagtgaacctgtgggacgaatatttc
gccccccgctacggcgaacccaacgccgggacactggcagcggtcaagctactggccagc
caggaagggctgttgctcgatccggtctacaccggcaaggccatggccggcctgctcgac
ggcatgggtcgcgaccgtttcgacgaaggcccgatcatcttcctgcacaccggcggcgca
ccggcgttgtttgcctacagcgcggcgttcccggcttag

DBGET integrated database retrieval system