KEGG   Pseudomonas fluorescens F113: PSF113_0302Help
Entry
PSF113_0302       CDS       T01734                                 

Gene name
cysQ
Definition
protein CysQ (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pfe00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    PSF113_0302 (cysQ)
Enzymes [BR:pfe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     PSF113_0302 (cysQ)
Transfer RNA biogenesis [BR:pfe03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    PSF113_0302 (cysQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
363062..363889
Genome map
AA seq 275 aa AA seqDB search
MTFSHSLMAPVVELALKAGEAILPFWRANVQVNHKADESPVTAADMAAHDVIVAGLTALA
PDIPILSEEDADIAQSVRAGWHRWWLVDPLDGTKEFISGSEEFTVNIALVEQGRVVFGVV
SMPTNGRFYVGGAGLGAWRGDKGGVPLPIAVRDVLAPGEAFTVVASRRHTSPEQERLLDG
LSGSLGELQLTSIGSSLKFCLVAEGAADCYPRLAPTSQWDTAAAQGVLEGAGGEVLDLSG
EPFCYPPRESLLNTSFLALPAKAVWRAKLLELARS
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgacattttctcattcgctgatggccccggtggtcgagctggcgctcaaggccggcgag
gcaatcctgccgttctggcgcgccaacgtgcaggtcaaccacaaggctgacgagtcgccg
gtgactgccgcagacatggccgctcatgatgtgatcgtggccgggttgacggcactggcc
ccggatattccgatcctctccgaagaagacgccgatattgcccaaagcgtgcgcgccggc
tggcatcgctggtggttggttgacccgttggatggcaccaaggaattcatttccggcagc
gaggagttcaccgtcaacatcgcgttggtggagcagggccgtgtggtgttcggggtggtg
tcgatgcccaccaatgggcgcttttacgtcggcggcgcagggctgggtgcctggcgtggc
gacaagggcggcgtgcctttgcctatcgcggttcgtgacgtcctggccccgggtgaagct
tttaccgtggtcgccagccgtcggcacaccagcccggagcaggaacgcctgctggatggc
ctgagcgggagcctgggtgagctgcaactgaccagtattggcagttcgttgaagttttgc
ctggtggccgaaggcgcggcggattgttatccacggctggcgccgacctcccaatgggac
accgccgccgcccagggtgtattggaaggcgccggtggcgaggtgttggacttgagcggc
gaaccgttctgctatccaccgcgtgaatcgctgttgaatacgtcgtttctggcgttgccg
gcgaaagcggtgtggcgtgcaaagttgttggaacttgcccgttcttaa

DBGET integrated database retrieval system