KEGG   Pseudomonas fluorescens F113: PSF113_0302Help
Entry
PSF113_0302       CDS       T01734                                 

Gene name
cysQ
Definition
protein CysQ (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:pfe00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
363062..363889
Genome map
AA seq 275 aa AA seqDB search
MTFSHSLMAPVVELALKAGEAILPFWRANVQVNHKADESPVTAADMAAHDVIVAGLTALA
PDIPILSEEDADIAQSVRAGWHRWWLVDPLDGTKEFISGSEEFTVNIALVEQGRVVFGVV
SMPTNGRFYVGGAGLGAWRGDKGGVPLPIAVRDVLAPGEAFTVVASRRHTSPEQERLLDG
LSGSLGELQLTSIGSSLKFCLVAEGAADCYPRLAPTSQWDTAAAQGVLEGAGGEVLDLSG
EPFCYPPRESLLNTSFLALPAKAVWRAKLLELARS
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgacattttctcattcgctgatggccccggtggtcgagctggcgctcaaggccggcgag
gcaatcctgccgttctggcgcgccaacgtgcaggtcaaccacaaggctgacgagtcgccg
gtgactgccgcagacatggccgctcatgatgtgatcgtggccgggttgacggcactggcc
ccggatattccgatcctctccgaagaagacgccgatattgcccaaagcgtgcgcgccggc
tggcatcgctggtggttggttgacccgttggatggcaccaaggaattcatttccggcagc
gaggagttcaccgtcaacatcgcgttggtggagcagggccgtgtggtgttcggggtggtg
tcgatgcccaccaatgggcgcttttacgtcggcggcgcagggctgggtgcctggcgtggc
gacaagggcggcgtgcctttgcctatcgcggttcgtgacgtcctggccccgggtgaagct
tttaccgtggtcgccagccgtcggcacaccagcccggagcaggaacgcctgctggatggc
ctgagcgggagcctgggtgagctgcaactgaccagtattggcagttcgttgaagttttgc
ctggtggccgaaggcgcggcggattgttatccacggctggcgccgacctcccaatgggac
accgccgccgcccagggtgtattggaaggcgccggtggcgaggtgttggacttgagcggc
gaaccgttctgctatccaccgcgtgaatcgctgttgaatacgtcgtttctggcgttgccg
gcgaaagcggtgtggcgtgcaaagttgttggaacttgcccgttcttaa

DBGET integrated database retrieval system