KEGG   Pseudomonas fluorescens F113: PSF113_0501Help
Entry
PSF113_0501       CDS       T01734                                 

Definition
(GenBank) Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
pfe00010  Glycolysis / Gluconeogenesis
pfe00020  Citrate cycle (TCA cycle)
pfe00620  Pyruvate metabolism
pfe01100  Metabolic pathways
pfe01110  Biosynthesis of secondary metabolites
pfe01120  Microbial metabolism in diverse environments
pfe01130  Biosynthesis of antibiotics
pfe01200  Carbon metabolism
Module
pfe_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pfe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSF113_0501
   00020 Citrate cycle (TCA cycle)
    PSF113_0501
   00620 Pyruvate metabolism
    PSF113_0501
Enzymes [BR:pfe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PSF113_0501
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding GCV_H RnfC_N HlyD_D23 PYNP_C HlyD_3 NQRA CAT
Motif
Other DBs
NCBI-ProteinID: AEV60539
UniProt: G8Q3T1
Position
complement(599506..601155)
Genome map
AA seq 549 aa AA seqDB search
MSELIRVPDIGSGEGEVIELFVKVGDRIEADQSILTLESDKASMEVPAPKAGVIKSLKVK
LGDRLKEGDELLELEVEGAAAAPEAAAPATAPAAAEKPAAAPAAAAAPAPAAAPAAATVQ
DIHVPDIGSSGKAKIIEVLVKVGDTVEADQSLITLESDKASMEIPSPAAGVVESIAVKLE
DEVGTGDFILKLKVAGAAAPAAPAQAAAPAAKTEAAPAPAPAPAAAPAAKAEAAPAPVAA
PAPSGAKVHAGPAVRQLAREFGVELSAVGPSGPHGRVLKEDVQAYVKAMMQKAKNAPAEG
ATGGAGIPPIPAVDFSRFGETEEVAMTRLMQIGASSLHRSWLNIPHVTQFDQADITELEA
FRVAQKAVAEKAGVKLTVLPLLLKACAHLLKELPDFNASLAPSGKAVIRKKYVHIGFAVD
TPEGLLVPVIRNVDQKSLLQLAAEAAALAEKARNKKLTADDMQGACFTISSLGHIGGTGF
TPIVNAPEVAILGVSKATIQPVWDGKAFQPKLMLPLSLSYDHRVINGAAAARFTKRLSDL
LGDIRTILL
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaactcattcgcgtacctgacatcggcagcggtgaaggtgaagtaattgaactg
tttgtgaaggtcggcgaccgtatcgaagccgaccagagcatcctgacgcttgaatcggac
aaggccagcatggaagtgcctgcgccgaaggccggtgtcatcaagagcttgaaagtgaag
ctgggcgaccgcctgaaagaaggcgacgaactgctggagctggaagtcgaaggcgccgct
gcggcgcctgaagcggcggccccggctaccgccccggcggcggctgaaaagcctgccgct
gcaccggctgctgcggcagctcctgctccggctgcggcgcctgccgctgccacggtccag
gacattcatgtcccggacatcggttcgtcgggcaaggccaagatcatcgaagtgctggtc
aaggtgggcgacaccgtcgaagccgaccagtcgctgatcaccctggaatccgacaaggcc
agcatggaaatcccatcgccggctgccggcgtggtggaaagcatcgcggtcaagctggaa
gatgaagtgggcacaggcgatttcatcctcaagctgaaagtagccggtgccgccgcacct
gccgcgcccgcccaagccgctgcgcctgccgccaagactgaagccgctccggctccggct
ccggctccggctgccgcgcctgccgccaaggccgaggccgccccagccccggtcgccgcg
cctgcgccaagcggtgccaaggtgcacgctggccctgcggtgcgtcaactggcccgtgaa
ttcggtgtcgagctgtcggccgtcggcccaagcggccctcacggtcgcgtgctcaaagaa
gacgtgcaagcctacgtcaaggccatgatgcagaaggccaagaacgcaccggccgaaggc
gccactggcggcgcgggcattccgccaatcccggcggtggacttcagccgcttcggcgaa
accgaagaagtggccatgactcgcctgatgcagatcggcgcgtcgagcctgcaccgcagc
tggctgaacattccgcacgtgactcagttcgaccaggctgacatcaccgagctggaagct
ttccgcgtcgcgcagaaagccgtggcggaaaaggccggcgtgaagctgaccgtactgcct
ctgctgctcaaggcttgtgcacacctgctcaaggaactgccggacttcaacgcctccctg
gccccaagcggcaaggctgtgatccgcaagaaatacgtgcacatcggctttgccgtcgac
accccggaaggcctgctggtgccggtcatccgcaacgtcgaccagaagagcctgctgcaa
ctggctgccgaagccgctgccctggccgaaaaagcccggaacaagaagctcaccgccgac
gacatgcaaggcgcttgcttcaccatctccagcctcggccacattggcggcaccggcttc
acgccgatcgtcaacgcgccggaagtggcgatcctgggtgtttccaaggccaccatccag
cctgtctgggacggtaaagccttccagccgaagctgatgctgccactgtcgctgtcctac
gatcaccgtgtgatcaacggcgccgccgctgcacgcttcaccaagcgtctgagcgacctg
ctgggcgacatccgcaccatcctgctgtaa

DBGET integrated database retrieval system