KEGG   Pseudomonas fluorescens F113: PSF113_0713Help
Entry
PSF113_0713       CDS       T01734                                 

Definition
Exodeoxyribonuclease V alpha chain (EC:2.3.1.85 3.1.11.5 3.6.1.15)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pfe00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PSF113_0713
Enzymes [BR:pfe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     PSF113_0713
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
857524..859620
Genome map
AA seq 698 aa AA seqDB search
MSRSFVDLLPKSSDDESLMELAPLSRAQDLLLLLTRWVERGWLRALDKAFVAFLHELAPD
DDPLVLLAAALTSHQLGHGHVCLDVFETLKEPDFALSLPPEGDLQTGVMLLPSQILATLD
GVHWCKVLASSRLVALAVDGSEEAQQRPLVLSGKRLYMRRYWGYERRIDEALRQRLIEHE
ASPGDLRERLDGLFGPANASGPIDWQKLACALATRGAFSIVTGGPGTGKTTTVVRLLALL
QAPAVEAGKPLRIRLAAPTGKAAARLTESISQQVRTLDVDDAVRERIPCDVTTVHRLLGS
RPGTRHFRHHAGNRLPLDVLVVDEASMIDLEMMANLLDALPAHARLVLLGDKDQLASVEA
GAVLGDLCRDAEEGWYSPRTRAWLESVSGENLAASDLQQDLDGTHPLAQQVVMLRHSRRF
GEGSGIGQLARWVNQQQPEKARQLLEQGQHADLSSLKLASEHDTKLEKLLLDGKPEGPQG
YRHYLSLLRQRRPAISRPLEDRCWTDWAREVLAAFDEFQLLCAVRKGPWGVEGLNLRITA
ALLKTRLIDSDHQWYEGRPVLMTRNDYGLGLMNGDIGITLKLPERDGPDAGKQVLRVAFP
RNDGQGGVRFVLPSRLNDVETVYAMTVHKSQGSEFTHTALILPDALNPVLTKELVYTAIT
RGKQWFSLIEPRAGVFEEAVRRKVKRLSGLMLELEQAD
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgttcttttgtcgacctgctgcccaaatcgtccgacgacgaaagcctgatggag
ttggcacccttgagccgtgcgcaggacctgctgttgttactgactcgctgggtcgagcgg
ggctggttgcgcgccttggacaaggcattcgttgcgttcctccatgaactggcgcccgac
gatgatcctttggttctgctcgccgctgcattgaccagccatcaactgggccacggccat
gtttgcctggatgtgttcgagaccctcaaggaaccggattttgcgctgtcgctgcctccc
gagggtgacctgcagacgggtgtcatgctgttgccatcgcaaatattggcgacactggac
ggcgtccattggtgcaaggtcctggcgtccagtcgtctggtggccctggccgtggatggg
agcgaagaggcgcagcaacgtccgttggtgttgtctggcaagcgtctttatatgcgccgc
tactggggttatgaacggcgaatcgatgaagcgttgcgtcaacggcttatcgagcatgaa
gcgtcgcccggcgacctgcgcgagcgtttggacgggttgttcgggccagccaatgccagt
ggcccgatcgattggcagaaactggcctgcgcgctggcgacccgcggggccttcagcatc
gtgaccggtggcccgggcaccggcaagaccaccaccgttgtgcgcctgctggcgctgctg
caggcaccggccgtcgaggctgggaagccgctgcggattcgcctggccgcgcccaccggc
aaggcggcggcgcgcctgaccgagtccatcagccagcaggtccggaccctggatgtggac
gacgcggtgcgcgaacgcattccctgcgacgtcacgacagtccatcgtttgctgggcagc
cgccccggcacccggcattttcgccaccatgcaggcaatcgcttgcctctggatgtgctg
gtggtcgatgaggcgtcgatgatcgacctggagatgatggccaatctgctggatgccctg
ccggcccatgcacggttggtgttgctgggggacaaggaccagttggcctccgtagaagcc
ggtgcggtgctgggggatttgtgtcgagacgccgaggagggctggtacagcccccggacc
cgagcctggcttgagtcggtcagtggtgaaaacctggcggccagtgacctgcagcaagac
cttgacggcactcatcccctggcacagcaagtggtcatgctcaggcattcccggcgcttc
ggcgaaggcagcgggattggtcaactggcgcgctgggtcaaccagcagcagcctgaaaag
gcccgtcagttgctggagcaggggcagcatgccgatctgtcttccctgaaattggcgagt
gaacacgacacgaaactggaaaagctgttactcgacggcaagccagaagggcctcagggt
tatcggcattacctgagcctgctacggcagcgacgcccggccatttctcgcccgctggaa
gaccgttgctggaccgattgggcccgggaagtcctggcggccttcgacgaattccaattg
ctttgcgcggtgcgcaaaggtccgtggggtgtcgaaggactgaacctgcgaatcaccgcc
gccttgctcaagacccgccttatcgatagcgatcatcagtggtacgaaggacgcccggtg
ctgatgacccgcaacgactatgggctggggctgatgaacggcgatatcggtatcaccctc
aagttgcccgagcgtgacgggcctgatgctggaaaacaggttctgcgggtcgctttcccg
cgcaacgacggtcagggcggtgtgcgtttcgtcctgcccagccgcctgaatgatgtggaa
accgtgtatgccatgacggtgcacaagtcccagggctcggaattcacccataccgcgttg
atcctcccggatgcgctgaacccggtattgaccaaggaactggtgtacaccgccattacc
cggggcaagcaatggttcagcctgatagagccgcgagcgggggtgttcgaggaggcggtg
cggcgcaaggtcaaacgcttgagcgggttgatgctggagttggagcaggctgactga

DBGET integrated database retrieval system