KEGG   Pseudomonas fluorescens F113: PSF113_0865Help
Entry
PSF113_0865       CDS       T01734                                 

Gene name
tpiA
Definition
(GenBank) TpiA
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
pfe00010  Glycolysis / Gluconeogenesis
pfe00051  Fructose and mannose metabolism
pfe00562  Inositol phosphate metabolism
pfe01100  Metabolic pathways
pfe01110  Biosynthesis of secondary metabolites
pfe01120  Microbial metabolism in diverse environments
pfe01130  Biosynthesis of antibiotics
pfe01200  Carbon metabolism
pfe01230  Biosynthesis of amino acids
Module
pfe_M00002  Glycolysis, core module involving three-carbon compounds
pfe_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pfe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSF113_0865 (tpiA)
   00051 Fructose and mannose metabolism
    PSF113_0865 (tpiA)
   00562 Inositol phosphate metabolism
    PSF113_0865 (tpiA)
Enzymes [BR:pfe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PSF113_0865 (tpiA)
Exosome [BR:pfe04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PSF113_0865 (tpiA)
  Exosomal proteins of bladder cancer cells
   PSF113_0865 (tpiA)
  Exosomal proteins of melanoma cells
   PSF113_0865 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEV60897
UniProt: G8Q8F2
Position
1043445..1044188
Genome map
AA seq 247 aa AA seqDB search
MVAGNWKMHGTRASVAELINGLRHLALPSGVDVAVFPPCLYINQVVDGLKGKSISVGAQN
SAVESMQGALTGEIAPSQLVDAGCSLVLVGHSERRQIMGEQDKTLIRKFAAAQACGLIPV
LCVGETLEQREAGKTLEVVGRQLGSIIEDLGVGAFAKAVIAYEPVWAIGTGLTASPQQAQ
DVHAAIRAQLAAENSEVARGVRLLYGGSVKAANAVELFGMPDIDGGLIGGASLNADEFGA
ICRAAGN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggtagctggtaactggaagatgcacggtacccgcgccagcgtcgctgagctgatcaat
ggccttcgtcatctggccttgcctagcggtgttgatgtcgcggtattcccgccttgcctg
tatatcaaccaagtggttgatggcttgaaaggtaaatcgatttcggtcggtgcgcagaat
tctgcggtggaatccatgcaaggtgcgctgaccggcgagattgcgccgagtcagttggtg
gatgcaggttgttccctggtcctggtcgggcactccgagcgtcgccagatcatgggcgag
caggacaagaccttgatccgcaagtttgctgcggcccaggcctgcggtctgattccggtg
ttgtgcgtaggggaaaccctcgagcagcgtgaagccggcaagacccttgaagttgtcggg
cgtcagctgggcagcatcatcgaagacctgggtgtcggtgcttttgcaaaggcagtcatt
gcttacgagccggtctgggccattggcaccgggctgactgcttcgccgcaacaggcgcag
gatgtgcatgcagccatccgcgcacagttggcggcagagaattctgaagtggcacgaggt
gtgcggcttctatacggcggcagcgtgaaggcggccaatgcggtcgaactgttcggcatg
ccggatatcgatggggggctcattggtggagcgtccctgaatgcagatgagttcggtgcg
atttgtcgcgccgcgggaaactga

DBGET integrated database retrieval system