KEGG   Pseudomonas fluorescens F113: PSF113_0865Help
Entry
PSF113_0865       CDS       T01734                                 

Gene name
tpiA
Definition
TpiA protein (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pfe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSF113_0865 (tpiA)
   01230 Biosynthesis of amino acids
    PSF113_0865 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSF113_0865 (tpiA)
   00051 Fructose and mannose metabolism
    PSF113_0865 (tpiA)
   00562 Inositol phosphate metabolism
    PSF113_0865 (tpiA)
Enzymes [BR:pfe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PSF113_0865 (tpiA)
Exosome [BR:pfe04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PSF113_0865 (tpiA)
  Exosomal proteins of bladder cancer cells
   PSF113_0865 (tpiA)
  Exosomal proteins of melanoma cells
   PSF113_0865 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1043445..1044188
Genome map
AA seq 247 aa AA seqDB search
MVAGNWKMHGTRASVAELINGLRHLALPSGVDVAVFPPCLYINQVVDGLKGKSISVGAQN
SAVESMQGALTGEIAPSQLVDAGCSLVLVGHSERRQIMGEQDKTLIRKFAAAQACGLIPV
LCVGETLEQREAGKTLEVVGRQLGSIIEDLGVGAFAKAVIAYEPVWAIGTGLTASPQQAQ
DVHAAIRAQLAAENSEVARGVRLLYGGSVKAANAVELFGMPDIDGGLIGGASLNADEFGA
ICRAAGN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggtagctggtaactggaagatgcacggtacccgcgccagcgtcgctgagctgatcaat
ggccttcgtcatctggccttgcctagcggtgttgatgtcgcggtattcccgccttgcctg
tatatcaaccaagtggttgatggcttgaaaggtaaatcgatttcggtcggtgcgcagaat
tctgcggtggaatccatgcaaggtgcgctgaccggcgagattgcgccgagtcagttggtg
gatgcaggttgttccctggtcctggtcgggcactccgagcgtcgccagatcatgggcgag
caggacaagaccttgatccgcaagtttgctgcggcccaggcctgcggtctgattccggtg
ttgtgcgtaggggaaaccctcgagcagcgtgaagccggcaagacccttgaagttgtcggg
cgtcagctgggcagcatcatcgaagacctgggtgtcggtgcttttgcaaaggcagtcatt
gcttacgagccggtctgggccattggcaccgggctgactgcttcgccgcaacaggcgcag
gatgtgcatgcagccatccgcgcacagttggcggcagagaattctgaagtggcacgaggt
gtgcggcttctatacggcggcagcgtgaaggcggccaatgcggtcgaactgttcggcatg
ccggatatcgatggggggctcattggtggagcgtccctgaatgcagatgagttcggtgcg
atttgtcgcgccgcgggaaactga

DBGET integrated database retrieval system