KEGG   Pseudomonas fluorescens F113: PSF113_0888Help
Entry
PSF113_0888       CDS       T01734                                 

Definition
phosphodiesterase/alkaline phosphatase D
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pfe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PSF113_0888
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    PSF113_0888
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PSF113_0888
Enzymes [BR:pfe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     PSF113_0888
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1070213..1071754
Genome map
AA seq 513 aa AA seqDB search
MSEFDLGRRRVMQAVGAGLLLPGLAPAVMASVKDRPVLTDGVQSGDLQGDRAMIWSRSDR
PARMVVEWDTRSTFSNPRRFVSPMVDARSDFTARVELIGLPRDQAIFYRVHFEDAQSGVA
SEPWLGHLRSVPQFKRNIRFVWSGDTVGQGFGINPDIGGMRIYEAMRLRLPDFFIHSGDT
IYADGPVPAQITAEGGRVWRNLTTEAKSKVAETLDEYRGNYRYNLMDENVRRFNAEVPQI
WQWDDHEVVNNWSPGKQLDERYQTKDIHSLVGRARQAWLEYAPMRLQKADGGGRIYRKLG
YGPLLDVFVLDMRSYREANDANLGAAKPFLGREQLNWLKRELKQSRAQWKVIAADMPIGL
GVPDGEVSPGVPRWEAVANGDPGAAQGRELEVAELLGYLRKHQVRNYVWLTADVHYCAAH
HYHPEHAAFQDFEPFWEFVAGPLNAGSFGPNALDKTFGPEVVFQKTPPAQNTSPFAGYQF
FGEVNIDGPSGEMSVVLRDLEGVAVFEKKLQPV
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaattcgacctgggccgtcgtcgtgtgatgcaagccgtgggggcggggttgttg
ttgccggggctggcgccggcggtgatggcttcggtcaaggatcggccggtactcaccgac
ggtgtgcagtcgggcgacttgcagggcgaccgggcgatgatctggagccgcagcgaccgt
ccggcgcggatggtggtggagtgggacacccgcagcacgttcagcaatccgcgccgcttc
gtctcgcccatggtcgacgcccgcagtgatttcaccgcccgggtcgagctcatcgggctg
ccccgcgaccaggcgattttctaccgtgtgcatttcgaagacgcccagagcggggttgcc
agcgaaccctggctcggccacctgcgcagcgtgccgcagttcaagcgcaacatccggttt
gtctggagcggcgacaccgtcggccagggcttcggcatcaacccggacatcggcggcatg
cgcatctacgaagccatgcgcctgcgcctgccggatttttttatccacagcggcgacacc
atctacgccgacggcccggtgccggcgcaaatcaccgccgagggtggacgcgtctggcgc
aacctcaccaccgaagccaagagcaaggttgccgagaccctggatgagtatcgcggcaac
tatcgctacaacctgatggacgaaaacgtccgtcgcttcaacgccgaagtgccgcagatc
tggcagtgggacgaccatgaggtggtcaacaactggtcgccgggcaagcaactggacgag
cgctaccagaccaaggatatccacagcctggtggggcgcgcacgacaggcctggctggaa
tacgcgccgatgcgcctgcagaaggccgacggcggtggacggatctaccgcaagctcggt
tacggcccgctgctggatgtgttcgtgctggacatgcgcagctaccgcgaagccaacgac
gccaacctcggcgcggccaaaccgttcctggggcgtgagcagttgaattggctcaagcgc
gaattgaagcaatcccgtgcccagtggaaagtcatcgccgccgacatgcccattggcctg
ggtgtgccggatggtgaagtcagccccggcgtgccgcgctgggaagcggttgccaacggt
gacccgggcgcggcccaggggcgtgaactggaggttgccgaactgctcggctacctgcgc
aagcatcaggtgcgcaactacgtctggctcaccgccgacgtccactattgcgccgcccat
cactaccaccccgaacacgccgcgttccaggatttcgaaccgttctgggagttcgtcgcc
gggccattgaatgccggcagcttcgggcccaatgccctggacaagaccttcggcccggaa
gtggtgttccagaaaacgcccccggcccagaacacctcgccgtttgccgggtatcagttc
tttggcgaggtgaacatcgatgggccgagcggggagatgagcgtggtgttgcgggacctg
gaaggcgtggcggtgttcgagaagaagttgcagccggtttga

DBGET integrated database retrieval system