KEGG   Pseudomonas fluorescens F113: PSF113_0956Help
Entry
PSF113_0956       CDS       T01734                                 

Gene name
hisD
Definition
protein HisD (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pfe01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:pfe00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1146532..1147869
Genome map
AA seq 445 aa AA seqDB search
MTAPTSIRRLNAADPDFAHHLDHLLSWESVSDDSVNQRVLDIIKAVRERGDAALVEFTQK
FDGLQVASMADLILPRERLELALTRITVPQREALEKAASRVRDYHERQKQDSWSYTEADG
TVLGQKVTPLDRAGLYVPGGKASYPSSVLMNAIPAKVAGVTEVVMVVPTPRGEINELVLA
AACIAGVDRVFTIGGAQAVAALAYGTESVPRVDKVVGPGNIYVATAKRHVFGQVGIDMIA
GPSEILVVCDGQTDPDWIAMDLFSQAEHDEDAQAILVSPDAEFLDKVAASIDKLLPTMDR
AEIINTSINGRGALIKVEDMAQAIEVANRIAPEHLELSVADPQAWLPQIRHAGAIFMGRH
TSEALGDYCAGPNHVLPTSGTARFSSPLGVYDFQKRSSIIFCSEQGASELGKTASVLARG
ESLSAHARSAEYRILDERSIEEQGN
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctcccacttcgattcgccgactcaatgctgccgacccggatttcgcacatcat
ctggatcatctgctgagctgggaaagtgtgtctgacgactcggtcaatcagcgggtgctg
gacatcatcaaggccgtgcgcgagcgtggcgatgccgccctggtggaattcacccagaag
ttcgacggcctgcaagtggcgtccatggccgacctgatcctgccgcgcgagcgcctggaa
ctggccctgacccggatcaccgtgccccagcgcgaagccctggaaaaggccgcgtcccgg
gtgcgcgactatcacgaaaggcagaagcaggactcctggagctacaccgaagccgacggc
acggtgctgggccagaaggtcacgccgctggaccgcgccggcctgtacgtgccgggtggc
aaggcctcctatccgtcctcggtgctgatgaacgccatcccggccaaggtcgccggcgtg
accgaagtggtcatggtcgtcccgaccccgcgcggtgaaatcaacgagctggtgctggcc
gccgcctgcatcgctggcgtggaccgggtgttcaccatcggcggtgcccaggccgtggcg
gcgctggcctatggcaccgaaagcgtgccgcgggtcgacaaggtggtcgggccgggcaat
atctatgtcgccactgccaagcgccacgtgtttggtcaggtcggcatcgacatgatcgcc
ggcccttcggaaatcctcgtggtgtgcgacggccagaccgacccggactggatcgccatg
gacctgttttcccaggccgagcacgacgaagacgcccaggcgatcctggtcagcccggac
gccgagttcctcgacaaggtcgccgccagcatcgacaagctgctgccgaccatggaccgc
gccgagatcatcaacacctcgatcaacggtcgtggtgcgctgatcaaagtcgaggacatg
gcccaggccatcgaagtcgccaaccgtatcgcgccggaacacctggaattgtcggtcgcc
gacccgcaggcctggttgccgcagatccgtcacgccggtgcgatcttcatggggcgccac
accagtgaggccctgggtgactattgcgcaggccctaaccacgtgctgccgacttccggc
accgcgcgtttctcgtcgccactgggggtgtatgacttccagaaacgttcgtcgatcatc
ttctgctccgagcagggtgcatccgaactgggcaagaccgcttcggtgctggcccgtggc
gaatcgctgagtgcccacgcgcgcagtgccgagtaccgcattcttgatgagcgctccatt
gaagagcaggggaactga

DBGET integrated database retrieval system