KEGG   Pseudomonas fluorescens F113: PSF113_1063Help
Entry
PSF113_1063       CDS       T01734                                 

Gene name
dsbC
Definition
protein DsbC (EC:5.3.4.1)
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
pfe  Pseudomonas fluorescens F113
Brite
Enzymes [BR:pfe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PSF113_1063 (dsbC)
Secretion system [BR:pfe02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   PSF113_1063 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1268492..1269223
Genome map
AA seq 243 aa AA seqDB search
MRLIQMFTAAAIALASTFAIADDAADKAIRKSLENLQLEVPIETISASPMAGLYEVKLKG
SRVLYASADGQYIVQGNLFELKDGKPVNLTEMTERQGISKLINGIPVAETVVYPAIGETK
SHITVFTDTTCPYCHKLHAEVPELNKRGIEVRYVAFPRQGLGSPGDEQLQAVWCSKDKKA
AMDKMVDGKEIKAAKCENPVSKQFALGQSIGVNGTPAIVLADGQVIPGYQPAPQVAKLAL
DAK
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttgatccagatgttcaccgccgccgccattgcgctggccagtacctttgccatc
gccgacgacgcggccgacaaggctatccgcaagagcctggaaaaccttcagctcgaagtg
ccgatcgaaaccatctcggccagtcccatggccggtctgtatgaggtcaagctcaagggc
agccgcgtgctttacgccagcgccgacggccagtacatcgtccagggcaacctgttcgag
ctcaaggacggcaagccggtcaatctcaccgagatgaccgagcgccagggcatttccaag
ttgatcaacggcattccagtcgctgaaaccgtggtctatccggcgattggcgaaaccaag
tcgcacatcaccgtgttcaccgacaccacctgcccgtattgccacaagctgcatgccgaa
gtgccggagctgaacaagcgcggcatcgaagtgcgctatgttgcgttcccgcgccagggc
ctgggctcgccgggcgatgagcagttgcaggcggtctggtgctccaaggacaagaaagcg
gccatggacaagatggtcgatggcaaggaaatcaaggccgccaagtgcgagaacccggtt
tccaagcagttcgcccttggccagtccattggtgtgaacggcacgccggccatcgttttg
gccgacggccaggtgattccgggctaccagccggcgccacaagtcgccaaactggccctg
gacgcgaaatga

DBGET integrated database retrieval system