KEGG   Pseudomonas fluorescens F113: PSF113_1162Help
Entry
PSF113_1162       CDS       T01734                                 

Gene name
pcm
Definition
hypothetical protein
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pfe  Pseudomonas fluorescens F113
Brite
Enzymes [BR:pfe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     PSF113_1162 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1378679..1379356
Genome map
AA seq 225 aa AA seqDB search
MAREQDDMLRRGIGMTSQRTRERLIQRLYEEGLSNAQVLEVIRRTPRHLFVDEALAHRAY
EDTALPIGHNQTISQPYMVARMSELLLEAGPLDKVMEIGTGSGYQTAVLSQLVERVFSVE
RIKVLQDRAKERLVELNLRNVVFRWGDGWEGWPALAPYNGIIVTAVATDVPQALLDQLAP
GGRLVIPVGAGEVQQLMLIVREEHGFSRHVLGAVRFVPLLNGPLA
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtgagcaagacgatatgctgcgccgcggaatcggcatgacctcccagcgcacc
cgtgaacgactgatccaaaggctctacgaagaaggcctgtccaacgcccaggtgctggag
gtgattcgccgcacgccacgccatctgttcgtcgatgaagccctggcccatcgcgcctat
gaagacacggcattgccgatcggccacaaccagaccatttcccagccgtacatggtggcc
cgcatgagcgagctgctgctggaggcggggccgctggacaaggtgatggagatcggtacc
ggttcgggttaccagacggcggtgttgtcgcagctggtcgagcgggtgttttccgtggag
cggatcaaggtactgcaggatcgcgccaaggagcgcctggttgagctgaacctgcgcaac
gtagtgtttcgctggggcgatggttgggaaggttggccagccctggcgccgtacaacggc
atcattgtgaccgcggtggccaccgatgtgccccaggctttgctggatcagcttgccccc
ggtggacgactggtcattccggtgggcgccggtgaagtccagcaactgatgctgatcgtg
cgcgaggaacacggtttttcgcgacatgtcctgggggcggtgcggttcgtgccgttactc
aatgggccgttggcctga

DBGET integrated database retrieval system