KEGG   Pseudomonas fluorescens F113: PSF113_1279Help
Entry
PSF113_1279       CDS       T01734                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pfe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSF113_1279
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSF113_1279
   00052 Galactose metabolism
    PSF113_1279
   00500 Starch and sucrose metabolism
    PSF113_1279
   00520 Amino sugar and nucleotide sugar metabolism
    PSF113_1279
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PSF113_1279
   00524 Butirosin and neomycin biosynthesis
    PSF113_1279
Enzymes [BR:pfe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PSF113_1279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1499701..1500651
Genome map
AA seq 316 aa AA seqDB search
MKLALVGDIGGTNARFALWKNHTLENIQVLATADYACPEDAIQVYLNGMGLKPGAIGSVC
LSVAGPVSGDEFRFTNNHWRLSNLAFCKTLQVEKLLLVNDFSAMALGMTRLRPDEYRVVC
EGTPEPMRPAVVIGPGTGLGVGTLLDLGEGRFAALPGEGGHVDLPMSSPRETQLWQHIYN
EIGHVSAETALSGSGLPRVYRAICAVDGHVPVLDTPESITAAGLAGDPIALEVLEQFCRW
LGRVAGNNVLTLGGRGGVYIVGGVVPRFADFFLESGFARCFADKGCMSDYFKGIPVWLVT
APYSGLMGAGVALEQS
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
ttgaaattggctttggtcggtgacatcggtgggaccaacgcacgcttcgcgctgtggaaa
aaccacaccctggaaaacatccaggtgttggctacggcggactatgcctgcccggaagat
gccatccaggtgtacctgaacggcatgggcctgaagccgggcgcgatcggttcggtgtgc
ctgtcggtggccggtccggtgagcggcgatgagtttcgctttaccaacaatcactggcgc
ctgagcaacctggcgttctgcaagaccctgcaggtggagaagctgttgctggtcaatgac
ttctcggccatggccctgggcatgacccgtttgcgtcccgatgaataccgggtcgtgtgc
gaaggcaccccggagccgatgcgtccggcggtggtgatcggcccgggcaccggcctgggc
gtcggtacgttgctggacctgggcgaaggccgtttcgcggcgttgccgggggagggcggc
catgtcgacctgcccatgagcagtccgcgggaaacccagctgtggcagcacatctacaac
gaaatcggccatgtcagcgccgaaaccgccctgagtggcagcggtttgcctcgggtatac
cgggccatttgcgcggtggacggccatgtgccggtgctcgacacccccgaatccatcacc
gccgccggcctggccggcgacccgattgccctggaagtgctcgagcagttctgccgctgg
ctggggcgcgtggccggcaacaatgtgttgacgctgggcgggcgtggtggtgtctacatc
gtcgggggtgtggtcccaaggtttgccgatttcttcctcgaaagtggtttcgctcgctgc
ttcgccgacaagggctgcatgagcgattacttcaagggcattccggtctggctggtgacc
gcgccgtactcgggcctgatgggcgcgggtgtggcgttggagcaaagttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system