KEGG   Pseudomonas fluorescens F113: PSF113_1616Help
Entry
PSF113_1616       CDS       T01734                                 

Definition
asparagine synthetase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pfe00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PSF113_1616
Enzymes [BR:pfe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     PSF113_1616
Peptidases [BR:pfe01002]
 Cysteine Peptidases
  Family C44
   PSF113_1616
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1872469..1874241)
Genome map
AA seq 590 aa AA seqDB search
MCGLAGELRFDQQPADLAAVERITHHLAPRGPDAWGFHSQGPVALGHRRLKIMDLSDGSA
QPMIDNQLGLSLAFNGAIYNYPELRSELEGLGYSFYSGGDTEVLLKGYHAWGEALLPKLN
GMFAFAIWERDAKRLFIARDRLGVKPLYLSRTGQRLRFASALPALLKGGDINPMLDPVAL
NHYLNFHAVVPAPRTLLAGVEKLPPATWMRIEADGSTEQKTWWTLPYGPRADEQHLNLED
WIDRVLDSTREAVAIRQRAAVDVGVLLSGGVDSSMLVGLLREVGVEDLSTFSIGFQDAGG
ERGDEFQYSDLIAKHYGTRHHQLRIDEKEIIEQLPAAFRAMSEPMVSHDCIAFYLLSREV
AKHCKVVQSGQGADELFAGYHWYPQVDGASDPYAAYRAAFFDRSYEEYAATVQPKWLTAN
DAAGDFVKEHFAQPGADAAVDKALRLDSTVMLVDDPVKRVDNMTMAWGLEARTPFLDYRL
VELSARVPAKFKLPDGGKQVLKEAARRVIPGEVIDRKKGYFPVPGLKHLEGNTLAWVREL
LLDPSQDRGLFNPAMLDRLLTDPNGQLTPLRGSRLWQLAALNLWLSEQGI
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggattagctggagagttacgtttcgatcaacaacctgcggaccttgcggccgta
gagcgaatcacccatcacctggcccctcgcggccccgacgcctggggttttcatagccaa
gggccagttgccctgggccatcggcgcctgaaaatcatggacctgtcggacggctcggcc
cagccgatgatcgacaaccaactgggcctgtccctggccttcaacggcgcgatctacaac
tacccggaactgcgcagcgagctcgaaggcctgggctacagcttctattcaggtggcgac
accgaagtgctgctcaagggctaccacgcctggggcgaagcgctgctgcccaagctcaac
ggcatgttcgccttcgccatctgggaacgcgatgccaagcggctgttcatcgcccgcgac
cgcctcggcgtcaagccgctgtacctgtcgcggaccggccaacggctacgtttcgcctcg
gcgttgccggcgctgctcaagggcggcgacatcaacccgatgctcgacccagtggcgctc
aaccattacctgaatttccacgcggtggtcccggcaccccgcaccttgctggccggtgtt
gaaaaactgccgcccgccacctggatgcgcatcgaagccgacggcagcaccgagcagaaa
acctggtggaccctgccttacggccctcgagccgacgaacagcacctgaacctggaagac
tggatcgatcgcgtgctcgacagcacccgtgaagcggtcgccattcgccaacgcgccgcc
gtggatgtcggcgtgctgctttcaggcggcgtcgattcaagcatgttggtgggtctgttg
cgggaagtgggcgtagaagacctgtcgaccttctctatcggtttccaggatgccggcggc
gagcgtggtgacgagttccagtattcggacctgatcgccaagcactacggcacccgccac
caccaactgcgcatcgacgaaaaagaaatcatcgagcaactgcccgcagcgttccgcgcc
atgagcgagccgatggtcagccacgactgcatcgccttctacctgctgtcgcgggaagtg
gccaagcattgcaaagtggtgcaaagcggccagggcgccgacgagctgttcgccggttac
cactggtacccgcaggtcgatggcgccagcgatccttacgcggcctatcgcgccgcgttc
ttcgaccgcagctacgaagaatatgccgccaccgtgcagcccaaatggctgacggccaac
gacgcggccggtgacttcgtcaaagaacatttcgcccagcccggggccgatgcggcggta
gacaaggccctgcgcctggacagcaccgtgatgctggtggacgacccggtcaagcgtgtc
gacaacatgaccatggcctggggcctggaagcgcgcacacccttcctggactaccgcctg
gtggaactctcggcccgggtcccagcgaagttcaagctgcccgatggcggcaagcaggtg
ctcaaggaagccgcccggcgggtgatccccggcgaggtgattgaccgcaagaaaggctat
ttcccggtgccaggcctcaagcacctggaaggcaacaccctggcctgggttcgcgagctg
ctgctggacccgagccaggaccgcggcctgttcaacccggccatgctcgaccgcctgctg
accgaccccaacggccagctcacgccattgcgcggctcgcgactgtggcaactggcggcg
ctgaacctgtggctcagcgagcaaggaatctga

DBGET integrated database retrieval system