KEGG   Pseudomonas fluorescens F113: PSF113_1683Help
Entry
PSF113_1683       CDS       T01734                                 

Definition
arylesterase (EC:3.1.1.2 3.1.1.5)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:pfe00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PSF113_1683
Enzymes [BR:pfe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     PSF113_1683
   3.1.2  Thioester hydrolases
    3.1.2.-  
     PSF113_1683
Lipid biosynthesis proteins [BR:pfe01004]
 Fatty acid synthase
  Component type
   PSF113_1683
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1959327..1959932
Genome map
AA seq 201 aa AA seqDB search
MRVWFLSAGLALMCMAQNAAAGTVLIVGDSISAAFGLDTRQGWVSLLEQRLKAEGFDDKV
VNASISGDTSAGGQARLPALLAAHKPDLVILELGGNDGLRGQPPTQLQQNLAAMIDSARA
SGAKVLLLGMQLPPNYGRRYTEAFARVYSTVAEEKKVPLVPFFLKDVGGIPTMMQGDGLH
PSVAAQGQLLENVWPTLKPLL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtgtggtttttgagtgccggcctggccttgatgtgcatggcccagaacgcagcg
gcgggtacagtcctgatcgttggcgatagtatcagcgcggctttcggcctggatacccgg
caagggtgggtgtcgttgctcgaacaacggctcaaggccgagggttttgacgataaagtg
gtcaatgcgtccatcagtggcgacaccagcgccggaggccaggcgcggctgccggcgctg
cttgcagcccataagccggacctggtgatcctggaactgggtggcaacgatggcttgcgc
ggacagccgccaacacaattgcaacaaaaccttgcagcgatgatcgacagcgcccgcgcc
agcggagccaaggtgcttttgctgggcatgcaactgccgcccaattacgggcggcgctac
accgaggcctttgcccgggtctacagcaccgtggccgaggagaagaaagtcccgttggtg
ccgtttttcctcaaggacgtcggtggtatcccgaccatgatgcaaggcgacggattgcac
ccgtccgtcgcggcccagggccagttgctggaaaatgtctggccgacgctgaaaccgctg
ctttga

DBGET integrated database retrieval system