KEGG   Pseudomonas fluorescens F113: PSF113_1683Help
Entry
PSF113_1683       CDS       T01734                                 

Definition
arylesterase (EC:3.1.1.2 3.1.1.5)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:pfe01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1959327..1959932
Genome map
AA seq 201 aa AA seqDB search
MRVWFLSAGLALMCMAQNAAAGTVLIVGDSISAAFGLDTRQGWVSLLEQRLKAEGFDDKV
VNASISGDTSAGGQARLPALLAAHKPDLVILELGGNDGLRGQPPTQLQQNLAAMIDSARA
SGAKVLLLGMQLPPNYGRRYTEAFARVYSTVAEEKKVPLVPFFLKDVGGIPTMMQGDGLH
PSVAAQGQLLENVWPTLKPLL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtgtggtttttgagtgccggcctggccttgatgtgcatggcccagaacgcagcg
gcgggtacagtcctgatcgttggcgatagtatcagcgcggctttcggcctggatacccgg
caagggtgggtgtcgttgctcgaacaacggctcaaggccgagggttttgacgataaagtg
gtcaatgcgtccatcagtggcgacaccagcgccggaggccaggcgcggctgccggcgctg
cttgcagcccataagccggacctggtgatcctggaactgggtggcaacgatggcttgcgc
ggacagccgccaacacaattgcaacaaaaccttgcagcgatgatcgacagcgcccgcgcc
agcggagccaaggtgcttttgctgggcatgcaactgccgcccaattacgggcggcgctac
accgaggcctttgcccgggtctacagcaccgtggccgaggagaagaaagtcccgttggtg
ccgtttttcctcaaggacgtcggtggtatcccgaccatgatgcaaggcgacggattgcac
ccgtccgtcgcggcccagggccagttgctggaaaatgtctggccgacgctgaaaccgctg
ctttga

DBGET integrated database retrieval system