KEGG   Pseudomonas fluorescens F113: PSF113_2008Help
Entry
PSF113_2008       CDS       T01734                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pfe00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PSF113_2008
Enzymes [BR:pfe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     PSF113_2008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2355835..2356749
Genome map
AA seq 304 aa AA seqDB search
MPAKVVVIGSLNMDLVTRAPRLPRGGETLIGKSFSTIPGGKGANQAVAAARLGAQVSMVG
CVGNDAYGEQLRGGLLAEGIDCQAVSVVEGASGVALIVVDDNSQNAIVIVAGANGALTAE
VLDSVDDVLQSADVIICQLEVPDATVGHALKRARELGKIVILNPAPASRTLPADWYACID
YLIPNESEAAVLSGLAVDSLETAEAAAAHLIAAGAGKVIVTLGAQGLMFANGASFEHFPA
LRVKAVDTTAAGDTFVGGFAAALAGGKNEVDAIRFGQAAAALSVTRAGAQPSIPTLLEVQ
AFKS
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgccagcaaaagtagtggtaataggcagcctgaacatggacctggtaacccgggcgccg
cgtctgccgcgtggtggtgaaacactgatcggcaagtcgttctccaccattccgggcggc
aagggggccaaccaggcggtggccgccgcgcgcctgggtgcgcaggtgtcgatggtcggt
tgcgtgggcaatgatgcctacggcgaacagttgcgtggcgggctgttggccgagggcatc
gactgccaggcggtcagcgtggtggagggggccagcggcgtggcgctgatcgtcgtcgac
gacaatagccagaatgcgatcgttatcgttgccggtgccaacggtgcgctcaccgccgag
gtcctggacagtgtcgatgacgtgctgcaaagcgccgatgtcatcatctgtcagctcgaa
gtgccggatgccaccgtcggccacgccctcaagcgcgctcgtgagttgggcaagatcgtc
atcctcaacccggcgccagcctcccggacattgccggccgactggtacgcctgcatcgac
tacctgattcccaatgaaagcgaagcagcggtgctgagcgggctggcggtggattccctg
gaaaccgccgaagccgccgcggcgcatctgatcgccgctggcgccggcaaggtgatcgtg
accctgggtgcccaggggttgatgttcgccaacggtgccagcttcgaacacttcccggcc
ctgcgggtcaaggccgtggacaccacggcggccggagacacctttgtcggcggcttcgcg
gcagccctggcgggcggcaaaaacgaggtcgacgcgattcgtttcggccaggccgccgcc
gcgctgtcggtcacccgcgcgggcgcgcagccttcaatccccacgttgctggaagtacag
gctttcaaatcatga

DBGET integrated database retrieval system