KEGG   Pseudomonas fluorescens F113: PSF113_2160Help
Entry
PSF113_2160       CDS       T01734                                 

Definition
Isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pfe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSF113_2160
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PSF113_2160
Enzymes [BR:pfe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     PSF113_2160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2531493..2532818)
Genome map
AA seq 441 aa AA seqDB search
MALTREQQIAALEKDWAENPRWKGVKRNYSAADVVRLRGSVQPEHTFAKMGAEKLWNLVT
QGAKPAFRPEKDFVNCMGALTGGQAVQQVKAGIQAIYLSGWQVAADNNSAESMYPDQSLY
PVDSVPTVVKRINNSFRRADQIQWKAGKNPGDEGYIDYFAPIVADAEAGFGGVLNAYELM
KSMIEAGAAGVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLTAARLAADVAGVPTIILAR
TDANAADLLTSDCDPYDQPFVTGTRTQEGFYKVRAGLDQAIARGLAYAPYADLIWCETAK
PDLDEARRFAEAIKKEYPDQLLSYNCSPSFNWKKNLDDATIAKFQRELSAMGYKHQFITL
AGIHNMWHSMFNLAHDYARNDMTAYVKLQEQEFADAAKGYTFVAHQQEVGTGYFDDMTTV
IQGGTSSVTALTGSTEEEQFH
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggcactgacacgcgaacagcaaattgcagcccttgaaaaagactgggctgaaaacccg
cgctggaaaggcgtgaagcgcaattattccgctgctgacgtcgtccgtctgcgtggctcg
gttcaacctgagcacacctttgcgaagatgggcgccgagaagctctggaacctggtgacc
cagggcgccaagccagccttccgtcccgagaaagatttcgtcaactgcatgggcgccctg
accggcggccaggctgtgcagcaagtcaaggccggcatccaggcgatctacctgtcgggc
tggcaagtggccgcggacaacaactccgccgagtcgatgtaccccgaccagtcgctgtac
ccggtggattcggttccaaccgtggtcaagcgcatcaacaactcgttccgtcgcgccgac
cagatccagtggaaagccggcaagaacccaggcgacgaaggctacatcgactacttcgcg
ccgatcgtggctgacgccgaagccggtttcggtggcgtcctgaacgcctacgagctgatg
aagagcatgatcgaggcaggcgccgccggcgttcacttcgaagaccaattggcttcggtg
aagaaatgcggccacatgggcggcaaggtactggttccaacccaggaagccgtgcagaaa
ctgaccgctgcccgcctggctgccgacgttgccggtgtaccgaccatcatcctggcccgt
accgacgccaacgccgctgacctgctgacctccgactgcgacccgtacgaccagccgttc
gtgacaggtacccgcacccaggaaggcttctacaaggtgcgcgccggtctcgaccaggcc
atcgcccgtggcctggcctacgcgccgtacgccgacctgatctggtgcgaaaccgccaag
ccggacctggacgaagcccgtcgcttcgccgaagcgatcaagaaggaatacccggaccaa
ctgctgtcgtacaactgctcgccttccttcaactggaagaaaaacctggacgacgcgacc
atcgccaagttccagcgcgaactgtccgccatgggctacaagcaccagttcatcaccctg
gccggcattcacaacatgtggcacagcatgttcaacctggcgcacgactacgcccgcaac
gacatgaccgcctacgtgaagctgcaagagcaagagttcgctgacgccgccaagggctac
accttcgtggctcaccagcaggaagtgggcaccggctacttcgacgacatgaccaccgtg
atccagggcggcacttcgtcggtgaccgcactgaccggctccaccgaagaagaacagttc
cactga

DBGET integrated database retrieval system