KEGG   Pseudomonas fluorescens F113: PSF113_2312Help
Entry
PSF113_2312       CDS       T01734                                 

Gene name
galU
Definition
protein GalU (EC:2.7.1.56 2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pfe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PSF113_2312 (galU)
   00052 Galactose metabolism
    PSF113_2312 (galU)
   00500 Starch and sucrose metabolism
    PSF113_2312 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    PSF113_2312 (galU)
Enzymes [BR:pfe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PSF113_2312 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2693823..2694662
Genome map
AA seq 279 aa AA seqDB search
MIKKCLFPAAGYGTRFLPATKAMPKEMLPVVNKPLIQYGVEEALDAGLTEISIVTGRGKR
ALEDHFDISYELENQIKGTDKEKYLVGIRKLLDECSFSYTRQTEMKGLGHAILTGRPLIG
DEPFAVVLADDLCVNLEGDGVLTQMVKLYKQFRCSIVAIQEVDPQETNKYGVIAGEMIRD
DIYRVHSMVEKPKPEDAPSNLAIIGRYILTPDIFDLIEQTEPGKGGEIQITDALMKQAQN
GCVMAYKFKGKRFDCGGAEGYIDATNFCFENFYKTGKAY
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagaaatgcttgttcccagcagccggttacggtactcgcttcctgccagcgact
aaagccatgcccaaagaaatgctgccggtggtgaacaagccactgatccagtacggcgtc
gaagaagccctcgatgcgggcctgactgaaatctctatcgtgactggccgtggcaaacgc
gcgctggaagaccatttcgacatcagctacgagctggaaaaccagatcaagggcaccgac
aaggaaaaatacctggtcggcatccgcaaactgctggatgagtgctcgttctcctacacc
cgccagaccgaaatgaaaggcctgggccatgcgatcctgaccggccgcccactgatcggt
gacgaaccgttcgccgtggtcctggcggacgacctgtgcgtcaacctcgaaggcgacggc
gtcctgacccagatggtcaagctgtacaagcagttccgctgctccatcgtggcgatccag
gaagtcgatccgcaggaaaccaacaagtacggcgtgattgccggcgaaatgatccgcgac
gacatctaccgcgttcacagcatggttgaaaaaccaaaacctgaagacgcgccgtcgaac
ctggcgatcatcggtcgctacatcctgaccccggacatcttcgacctgatcgaacagacc
gagccaggcaagggcggcgaaatccagatcaccgatgccctgatgaaacaggcccagaac
ggctgcgtcatggcctacaagttcaagggcaagcgtttcgactgcggtggcgccgaaggc
tacatcgacgcgaccaacttctgcttcgagaacttctacaagacgggcaaggcttactga

DBGET integrated database retrieval system