KEGG   Pseudomonas fluorescens F113: PSF113_2332Help
Entry
PSF113_2332       CDS       T01734                                 

Definition
pyrazinamidase nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    PSF113_2332
Enzymes [BR:pfe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     PSF113_2332
    3.5.1.-  
     PSF113_2332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2716639..2717370)
Genome map
AA seq 243 aa AA seqDB search
MAVCQSTHLAQAIQLLSKNHFKEDSFMGVPANRALTTALVVIDVQNDFIPGGQLAVPGGD
EIVPLINQLGHSFRHVVLAQDWHPAGHASFASSHPGKQPFDIVQLPYGEQKLWPDHCIQG
SNGAALHPALGLEHAKLIIRKGCNPDIDSYSAFMEADHQTPTGLTGYLKERGIDTVYLVG
LALDFCVMFSALDARLAGFNAFVVLDACRGIDSEGSMEAAIRRMQEAGVQLIESSAIDGR
PFA
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgtgtcagtctacgcacctggcccaagccattcagctactatcgaagaaccac
ttcaaggaggattcattcatgggcgttcccgccaaccgggctttgaccaccgcgctggta
gtaatcgatgtacagaacgacttcatccccggcggccaactggcggtgccggggggcgat
gagatcgtgccgctgatcaaccagctcggccattcattcaggcacgtcgtccttgcgcag
gactggcacccggccgggcacgcctcgtttgcctccagccatccgggcaagcaaccgttc
gacatcgtccaattgccctacggcgagcaaaaactctggcccgaccactgcatacagggc
agcaacggtgccgcgctgcacccggcacttgggcttgagcatgccaagctgatcattcgc
aaaggctgcaacccggacatcgacagttactccgccttcatggaagcggatcaccagacc
cccaccggtttgaccggctacctcaaggaacgcggcatagacaccgtgtacctggtgggg
ctggccctggatttttgcgtgatgttctcggcgctggatgcccggttggccgggttcaac
gcgtttgtggtactggacgcctgccggggtattgatagcgagggctcgatggaagcggcg
atccggcgaatgcaggaagcgggcgtgcaattgatcgagtccagcgcgatagacggtcgc
cctttcgcttga

DBGET integrated database retrieval system