KEGG   Pseudomonas fluorescens F113: PSF113_2640Help
Entry
PSF113_2640       CDS       T01734                                 

Definition
(GenBank) Enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
pfe00071  Fatty acid degradation
pfe00280  Valine, leucine and isoleucine degradation
pfe00281  Geraniol degradation
pfe00310  Lysine degradation
pfe00360  Phenylalanine metabolism
pfe00362  Benzoate degradation
pfe00380  Tryptophan metabolism
pfe00410  beta-Alanine metabolism
pfe00627  Aminobenzoate degradation
pfe00640  Propanoate metabolism
pfe00650  Butanoate metabolism
pfe00903  Limonene and pinene degradation
pfe00930  Caprolactam degradation
pfe01100  Metabolic pathways
pfe01110  Biosynthesis of secondary metabolites
pfe01120  Microbial metabolism in diverse environments
pfe01130  Biosynthesis of antibiotics
pfe01212  Fatty acid metabolism
Module
pfe_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pfe00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PSF113_2640
   00650 Butanoate metabolism
    PSF113_2640
  Lipid metabolism
   00071 Fatty acid degradation
    PSF113_2640
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PSF113_2640
   00310 Lysine degradation
    PSF113_2640
   00360 Phenylalanine metabolism
    PSF113_2640
   00380 Tryptophan metabolism
    PSF113_2640
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PSF113_2640
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PSF113_2640
   00281 Geraniol degradation
    PSF113_2640
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PSF113_2640
   00627 Aminobenzoate degradation
    PSF113_2640
   00930 Caprolactam degradation
    PSF113_2640
Enzymes [BR:pfe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PSF113_2640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AEV62647
UniProt: G8PYK9
Position
3111012..3111824
Genome map
AA seq 270 aa AA seqDB search
MSQYQAFNVELADNIAHVQINRPEKINSMNAAFWSEIIEIFQWIDDTDAARVVVLSGAGK
HFSSGIDLMMLAGVANELGKDVGRNARLLRRKILQLQASFNAVDNCRKPVLAAIQGYCLG
GAIDLIAACDMRYAAEDAQFSIKEIDIGMAADVGTLQRLPRIIGDGMLRELAYTGRTFGA
DEARSIGLVNRVYSDTASLLDGVMGIAREIAAKSPIAVTGTKEMISYMRDHRIDDGLEYV
ATWNAAMLQSTDLRVAMAAHMSKQKPEFQD
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaataccaagcgttcaacgtcgaacttgcagacaacattgcccatgtgcagatc
aatcgcccggaaaagatcaattcgatgaacgccgcgttctggagcgagatcatcgagatc
ttccaatggatcgacgacaccgatgccgcacgggtagtggtgctcagcggcgccggcaag
catttctcctcggggatcgacctgatgatgctggcgggcgtggccaacgaattgggcaag
gacgtagggcgcaatgcacgcctgctgcggcgcaagatcctgcaactgcaagcctcgttc
aacgccgtggacaattgccgcaagcccgtgctcgcggcgatccaaggctactgcctgggc
ggggccatcgacctgattgccgcctgcgacatgcgttacgcggccgaggatgcgcaattc
tccatcaaggagatcgatatcggcatggccgccgatgttggcacattgcaacgcttgccc
cggatcatcggggacggcatgctgcgtgaactcgcttatacggggcgcacttttggtgcc
gacgaagcgcgcagcatcggcctggtcaatcgtgtctacagcgacaccgccagcctgctc
gacggcgtgatgggcattgcccgggaaatcgccgccaagtcgccgattgccgtgaccggt
accaaggaaatgatcagctacatgcgcgaccaccgcattgacgacggcctggagtacgtc
gccacctggaacgccgccatgttgcaatcgaccgacctgcgcgtggccatggccgcccat
atgagcaaacagaaacctgaatttcaggattga

DBGET integrated database retrieval system