KEGG   Pseudomonas fluorescens F113: PSF113_2716Help
Entry
PSF113_2716       CDS       T01734                                 

Definition
protein-glutamate methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:pfe02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:pfe02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3189707..3190294
Genome map
AA seq 195 aa AA seqDB search
MNRTKDRSNPAIEAIVVGASAGGVDALLRVFGHLRNGFGVPILVVLHLPDERDSQLAHVF
GHRLAVPVEEARDKQDIVPGTLYVATPGYHLSVEADRSLSLSLEEPVHHSRPSIDVLFES
AADVYGQKLLAVVLTGANNDGARGLAKVRALGGITVVQDPGEAQVSTMPEAALALHEPDH
ILTLQGIGQLLAGLE
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgaaccggacgaaggacagatccaacccggccatcgaggccattgtcgtcggtgcatcg
gccggtggcgtcgatgcgttgctgagggtgttcggtcacctgcgcaacggctttggcgtg
cctatcctggtggtattgcatttgccggatgagcgcgacagccaactggcccatgtattt
ggtcatcgtctggcggtgccggtggaggaagccagggacaagcaagacatcgtgccggga
accttgtacgtcgccacgcccggctatcacttgtcggtcgaggccgaccgtagcctgtcg
ttgagcctggaggagcctgtacaccattcgcggccatccatcgatgtgctgtttgagtcg
gccgccgatgtctacggccagaagttgctggccgtggtgctgaccggtgccaacaacgat
ggcgcccggggcttggcgaaggtcagggcgctgggcgggatcacggtggtccaggacccc
ggtgaagcccaggtctcgaccatgcccgaagcggcgctggccctgcacgagcccgaccat
atccttactttgcaaggcatcggccaattgctggccgggctggaatga

DBGET integrated database retrieval system