KEGG   Pseudomonas fluorescens F113: PSF113_2849Help
Entry
PSF113_2849       CDS       T01734                                 

Definition
acyl-CoA synthetase(AMP-forming)/AMP-acid ligase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pfe01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pfe00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pfe00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:pfe00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:pfe00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3358644..3360317
Genome map
AA seq 557 aa AA seqDB search
MLVMRDYSSATSQFDYLHTVNTALHGSLEALNACVECCDRHALPGRIALFWEGRDGSDAT
WTYRDLQDNAARFANFLRAQGVGKGDKVAGLLPRTAELLIVVLATWRIGAVYQPLFTAFG
PKAIEHRLGSSGARVVVTDAVNRPKLEEVASCPTIVTVGGEKGQGIVRGDYSFWAEVANH
SSQCEPLMLTGEDPFLLMFTSGTTGPAKALSVPLKAIVAFQSYMRDAVDLRPEDAFWNVA
DPGWAYGIYFGVTGPLAMGHPITFYDGPFTLESTCRVINKYGITNLTGSPTAYRLLIAGG
EQFARSIKGKLRIVSSAGEPLNPEVIRWFADNLNVVIHDHYGQTELGMVLCNHHGLEHPV
HLGAAGFASPGHRIVVLDENQRELGVGQPGILALDRSQSPMCWFAGYAGGPTKAFVGDYY
LSGDTVELNPDGSISFVGRSDDVITTSGYRVGPFDVESALIEHPAVVEAAVIGKPDPERT
ELVKAFVVLSAQYRAAPELAEELRQHVRKRLAAHAYPREIEFVSDLPKTPSGKLQRFILR
NQEIAKAQEAAAHNVSA
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgctggtcatgcgcgattattcgtccgccacttcgcagttcgattacctgcacaccgtc
aacaccgcactgcacggctcgctcgaggcgctcaatgcctgcgtcgagtgttgcgaccgg
catgcgttgccggggcgcatcgccttgttctgggagggccgtgacggcagcgatgcgact
tggacttaccgtgacctgcaggacaacgccgcgcggttcgccaatttcctgcgcgcccaa
ggcgtcggcaagggcgacaaagtggccggcctgctgccgcgcaccgctgaactgttgatc
gtggtgctcgccacctggcgcatcggggcggtgtatcaaccgctgttcaccgcgttcggg
cccaaggccatcgagcaccggctcggcagctcgggggcgcgcgtggtcgtcaccgatgcg
gtcaaccgtcccaagctcgaagaagtcgccagttgccccaccatcgtcacggtcggcggc
gaaaagggccagggcatcgtgcgtggcgactacagtttctgggccgaagtggcgaaccat
tccagccagtgcgagccgctgatgctcaccggcgaagacccgttcctgttgatgttcacc
tccggcaccacgggacctgccaaggcgctgtcggtgccgctcaaggccatcgtggcgttc
cagagctacatgcgtgacgcggtagacctgcgccctgaagacgcgttctggaacgtcgcc
gacccgggttgggcctatggcatctattttggcgtgaccgggccgctggcgatggggcat
ccgattaccttctacgatggcccgttcaccctggaaagcacctgccgggtcatcaacaaa
tacggcatcaccaacctgaccggatcgcccacggcctatcgcctgttgatcgccggtggc
gagcagttcgcccgctcgatcaagggcaagctgcgcatcgtcagcagcgccggtgagccg
ttgaacccagaggtgatccgttggttcgccgataacctgaacgtagtgatccacgaccat
tacggccagaccgaactgggcatggtgctgtgcaaccaccatgggctggaacacccggtg
catctgggcgcggccggttttgcttcgccgggccatcggatcgtggtgctggatgaaaac
cagcgcgagctgggcgtaggccagccgggcattctcgcgctggaccgcagccagtccccc
atgtgctggttcgccggttacgcaggcgggccgaccaaggctttcgtcggtgactactac
ttgagcggcgataccgtggagctgaatccggacggcagcatcagcttcgtcggccgcagc
gacgacgtgatcaccacctccggctaccgggtcggtccgtttgacgtggaaagtgcgctg
atcgaacacccggccgttgtggaagcggcggtgattggcaagcccgacccggaacgcacc
gagttggtgaaggccttcgtggtgctcagcgcccagtaccgcgccgcacccgagctggcc
gaagagttgcgccaacacgtacgcaaacgcctggcagcccatgcgtatccccgtgaaatc
gaatttgtcagcgatttgccgaaaaccccaagcggcaaattgcagcgctttatcttgcgc
aaccaagagatcgccaaagcccaagaggctgcggcgcacaacgtttcagcttga

DBGET integrated database retrieval system