KEGG   Pseudomonas fluorescens F113: PSF113_2997Help
Entry
PSF113_2997       CDS       T01734                                 

Gene name
nosZ
Definition
(GenBank) NosZ
  KO
K00376  nitrous-oxide reductase [EC:1.7.2.4]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
pfe00910  Nitrogen metabolism
pfe01120  Microbial metabolism in diverse environments
Module
pfe_M00529  Denitrification, nitrate => nitrogen
Brite
KEGG Orthology (KO) [BR:pfe00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    PSF113_2997 (nosZ)
Enzymes [BR:pfe01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     PSF113_2997 (nosZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupredoxin_1 COX2 Cu-oxidase_3 TAT_signal
Motif
Other DBs
NCBI-ProteinID: AEV63001
UniProt: G8Q381
Position
complement(3530080..3531966)
Genome map
AA seq 628 aa AA seqDB search
MEEPRGVSRRSFLGTGAVTGAVLAGATALGAGTFTRESWAAAAKEAKSKVHVGPGELDEY
YGFWSGGHQGEVRVLGVPSMRELMRIPVFNVDSATGWGLTNESKRILGDSAKYQNGDCHH
PHISMTDGKYDGKYLFINDKANSRVARIRLDIMKCDKILTVPNVQAIHGLRLQKVPYTKY
VFANAEFVIPHPNDGHTFDLQDKNSFTMFNAIDAEKMEMAFQVIVDGNLDNSDADYTGKY
AASTCYNSEKAYDLGGMMRNERDWVVVFNIPRIEAAIKAGKFINLDGSKVPVVDGRKTDG
KDSEFTRYIPVPKNPHGLNTSSDGKYFIANGKLSPTVSMIAIDRLDDLFADRFKDPREVI
VAEPELGLGPLHTTFDGRGNAYTTLFIDSQVVKWNMDEAIRAYKGEKVNYIKQKLDVQYQ
PGHNHASLTETSEADGKWLVVLCKFSKDRFLPTGPLHPENDQLIDISGEEMKLVHDGPAF
AEPHDCILARRDQIKTQKIWNRNDPFFAGTVELAKKDGINLETDNKVIRDGNKVRVYMTS
MAPAYGLTEFTVKQGNEVTVTITNIDQIEDVSHGFVMTNHGASMEISPQQTSSITFTADK
AGLHWYYCSWFCHALHMEMVGRMLVEKA
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
gtggaagaacccaggggtgtcagccggcgcagctttcttggcactggcgcggtaaccggt
gcggtactggccggcgcgacggcgctgggggccgggacgttcacccgtgagtcctgggcg
gcggcggccaaggaggccaagtccaaggtccacgtcgggcctggggagctggacgaatac
tacggtttctggagcggcggccaccagggcgaggtacgggtgctgggggtgccgtcgatg
cgtgagctgatgcgcatcccggtgttcaacgtcgactctgccaccggttggggcctgacc
aacgaaagcaagcgcattctgggcgacagcgccaagtaccagaacggcgattgccaccac
ccgcacatctccatgaccgacggcaagtacgacggcaaatacctgttcatcaacgacaag
gccaactcgcgggtcgcgcgcattcgcctggacatcatgaagtgcgacaagatcctcacc
gtgcccaacgtgcaggccatccacggcctgcgcctgcaaaaggtgccgtacaccaagtac
gtgttcgccaacgctgagttcgtgatcccgcaccccaacgacggccataccttcgacctg
caggacaaaaacagcttcacgatgttcaatgccatcgatgccgagaaaatggaaatggcg
ttccaggtgatcgtcgacggcaacctggacaactccgacgctgactacaccggcaaatac
gccgccagcacctgctacaactccgagaaggcctacgacctgggcggcatgatgcgcaac
gagcgcgactgggtggtggtgttcaacatcccgcgtatcgaggcggcgatcaaggccggc
aagtttatcaacctggacggctccaaggtgccggtggtcgatggccgcaagaccgatggc
aaggactccgaattcacccgctacattcccgtgccgaagaacccccacgggctcaatact
tcgtcggacggcaaatacttcatcgccaacggcaagctgtcgcccacggtctcgatgatc
gccatcgatcgcctggacgacttgttcgccgaccgcttcaaggacccacgcgaagtgatc
gtcgccgagccggaactggggcttgggccgctgcacaccacgttcgacgggcgcggcaat
gcctacaccaccttgttcatcgatagccaggtggtgaagtggaacatggacgaggccatc
cgtgcctacaagggcgagaaggtcaactacatcaagcagaagctcgacgtccagtaccag
cccggccacaaccatgcgtccctcaccgaaaccagcgaggcggacggcaagtggctggtg
gtgttgtgcaaattctccaaggaccgcttcttgcccaccggcccattgcacccggagaac
gatcagttgatcgacatttccggtgaagaaatgaagctggtgcacgacggcccggcgttc
gccgaaccccatgactgcattctcgctcggcgcgaccagatcaagacccagaaaatctgg
aaccgcaacgatccgttcttcgccggcaccgtggagctggcgaagaaggacggcattaac
ctggaaaccgacaacaaggtcatccgcgacggcaacaaggtgcgggtgtacatgacgtcg
atggcgccggcctatggcctgacggagttcaccgtcaagcaaggcaacgaggtgacggtg
accatcaccaacatcgaccagatcgaagacgtgtcccacggctttgtcatgaccaaccac
ggcgcgagcatggagatcagcccgcaacagacctcatcgatcacttttaccgccgacaag
gccggtttgcactggtactactgcagctggttctgccacgccctgcacatggaaatggtc
ggacgcatgctggttgaaaaggcctga

DBGET integrated database retrieval system