KEGG   Pseudomonas fluorescens F113: PSF113_3106Help
Entry
PSF113_3106       CDS       T01734                                 

Definition
(GenBank) zinc-binding alcohol dehydrogenase family protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
pfe00010  Glycolysis / Gluconeogenesis
pfe00071  Fatty acid degradation
pfe00350  Tyrosine metabolism
pfe00625  Chloroalkane and chloroalkene degradation
pfe00626  Naphthalene degradation
pfe01100  Metabolic pathways
pfe01110  Biosynthesis of secondary metabolites
pfe01120  Microbial metabolism in diverse environments
pfe01130  Biosynthesis of antibiotics
pfe01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pfe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSF113_3106
  Lipid metabolism
   00071 Fatty acid degradation
    PSF113_3106
  Amino acid metabolism
   00350 Tyrosine metabolism
    PSF113_3106
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PSF113_3106
   00626 Naphthalene degradation
    PSF113_3106
Enzymes [BR:pfe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PSF113_3106
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: AEV63108
UniProt: G8Q5B2
Position
complement(3663216..3664199)
Genome map
AA seq 327 aa AA seqDB search
MRAMVLHTIGQPLQLEERPQPTPAAGQMLIKVQACGVCRTDLHLFDGELPQARLPRVPGH
EIVGEVTAVGAQVAPDWIGRRVGVPWLGWTCGVCEFCRSGRENLCDQALFTGCQLDGGYA
DYTVADARFCFPLPDTLEAAEAAPLLCAGLIGFRALQMAQNAPHLGLYGFGAAAHLAIQV
AVGRGQQVYAFTRPGDDSGQDYARSLGATWAGASDQLPPHLLDASLIFAPVGELVPLALQ
ATAKGGCVVCAGIHMSDIPTFPYRLLWQERSVRSVANLTRADGVAFFEQIQRTPVHCNVT
CYPLVQANQALERLRTGQVNGAIVLIP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccatggtcctgcatacgattggccagcccttgcaactggaggaacgcccccaa
ccgacgccggccgccgggcaaatgctgatcaaggtgcaagcctgcggtgtgtgccgcacc
gacttgcatctgttcgacggtgaactgccccaggctcgattgcctcgggtaccgggccac
gagattgtcggtgaggtcaccgccgtcggcgcgcaggtggccccggactggatcggccga
cgggtaggtgtgccctggctggggtggacgtgtggcgtgtgtgagttctgccgctccggc
cgggagaacctctgcgaccaggcactgttcaccggctgccagctggacggtggttatgcc
gactacaccgtcgccgatgcgcggttctgcttccctctgcccgacacactggaggccgcc
gaagccgcgcccttgctgtgtgcagggctgatcggtttccgggccttgcagatggcgcaa
aacgcccctcacttgggcctttatggcttcggtgccgctgcgcacctggcgatccaggtc
gccgtgggccggggccagcaagtctatgccttcactcgccccggtgatgatagcggccag
gactatgcccgttcgctgggcgcgacctgggccggggcatccgaccagctcccgccacat
ctactggacgccagcctgatcttcgcccccgtcggcgaattggtgccgctggccttgcaa
gccaccgccaaaggcggttgcgtggtatgtgcaggcattcacatgagcgacatccccacc
ttcccctatcgcctgttgtggcaggagcgcagcgtgcgttcagtggccaatctgacccgc
gcggacggcgtggcatttttcgagcagatccagcgcacgcccgtacactgcaacgtgacc
tgctaccccctggtccaggccaaccaggccctggagcgcctgaggaccggacaggtcaac
ggggccatcgtactcatcccttga

DBGET integrated database retrieval system