KEGG   Pseudomonas fluorescens F113: PSF113_3203Help
Entry
PSF113_3203       CDS       T01734                                 

Definition
1,4-alpha-glucan branching protein (EC:2.4.1.18 3.2.1.-)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pfe00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3771307..3773541
Genome map
AA seq 744 aa AA seqDB search
MSVSNKEPQGQAKESLLPAPHDIDALVRAEHHDPFSILGPHGDDAGGQFIRAYLPGALSV
HVLARDGGEELGELQPTATPGLFVGHFDRAQAYLLRTRWAGGEQVAEDPYSFGPLLGEMD
LYLFAEGNHRDLSSCLGAQLTTVDGIDGVRFAVWAPNARRVSVVGDFNVWDGRRHPMRIR
YPSGVWEIFIPRLGAGEGYKYEILGAHGILPLKADPVALATQMPPDTASRVASPLKIEWQ
DDEWMQHRRERQLPGAPLSIYELHAGSWQCEIDEAGEVARQYNWHEMAERLIPYVKDLGF
THIELMPIMEHPFGGSWGYQPLSQFAPTARFGSPDDFAAFVNACHQANIGVILDWVPAHF
PTDTHGLAQFDGTALYEYGNPLEGFHQDWDTLIYNLGRTEVHGFMLASALHWLKHFHVDG
LRVDAVASMLYRDYSRKAGEWVPNRHGGRENLEAIDFLRHLNDVVALETPGALVIAEEST
AWPGVSQSTQQGGLGFAYKWNMGWMHDSLHYIQQDPVYRAHHHNELSFGLVYAWSERFVL
PISHDEVVHGKRSLIDKMPGDRWQKFANLRAYLSFMWGHPGKKLLFMGCEFGQWREWNHD
QQLDWYLLQYPEHRGVQKLVSDLNRLYREEPALHDQDDAPQGFQWLIGDDALNSVYAWLR
WSKEGRPVLVVANFTPVPREAYRVGVPFGGRWVELLNSDADTYAGSNYGNGGGASTEEVP
SHGQALSLELNLPPLAVLILRPEG
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtctcgaacaaagaaccacaggggcaggccaaagagtcgttgctgccggcgccc
catgacatcgacgcgctggtgcgcgccgaacaccacgacccgttttccatcctcgggcct
catggcgacgacgccggcggccaattcattcgcgcgtatctgcccggagccctgagcgtg
catgtgctggcccgtgatggcggcgaagagctgggggaactgcaacccaccgcaaccccg
gggctgttcgtcggccatttcgaccgtgcccaggcgtacttgctgcgcacccgttgggct
ggcggcgagcaggttgccgaagacccctacagcttcggtccgttgctgggggagatggac
ctttacctgttcgccgagggtaatcaccgcgacctcagttcctgcctcggtgcgcaactg
accaccgtcgatggcatcgacggcgtgcggttcgcggtctgggcgccgaatgcccggcgc
gtttcggtggtcggggatttcaacgtctgggacgggcgtcggcatccgatgcgcatccgt
tatccgtccggcgtgtgggagatattcatccccaggctaggtgccggtgagggttacaag
tatgaaatcctcggcgcccacggcatcctgccgctcaaggccgacccggtggccctggcc
acgcagatgccgccagacacggcttcgagagtcgcctcacccctgaagatcgagtggcag
gacgacgagtggatgcagcaccgtcgcgagcggcagctcccgggggcgccgctgtcgatc
tacgaattgcacgccggctcctggcagtgcgaaatcgacgaggcgggggaggtggcccgg
cagtacaactggcatgaaatggccgagcggctgatcccgtatgtcaaggacctgggcttc
acccacatcgagctgatgccgatcatggagcacccgttcggcggctcctggggctatcag
ccgctgtcgcaattcgcaccgacggcacgcttcggctcgccggacgatttcgcggcgttc
gtcaacgcctgccaccaggccaatatcggcgtcatcctcgactgggtgccggcgcatttc
cccaccgacactcacggcctggcccagttcgacggcaccgcgctgtacgaatacggcaac
ccgctggaaggcttccaccaggattgggacacgctgatctacaacctgggccgcaccgaa
gtgcacggcttcatgctggcgtcggcgctgcattggctcaagcatttccacgtcgatggc
ctgcgggtggatgccgtggcctcgatgttgtaccgcgactattcgcgcaaggccggtgag
tgggtgcctaaccgccacggcggacgggaaaacctcgaagccatcgatttcctgcggcac
ctcaacgatgtggtggcgctggaaacccccggtgcgctggtcatcgccgaagagtccacg
gcgtggccgggggtcagccaaagcacccagcagggcggcctgggtttcgcctacaagtgg
aacatgggctggatgcacgattcgctgcactacatccagcaagacccggtgtaccgcgcc
catcaccataacgaactgagctttggcctggtgtatgcctggtccgagcgcttcgtcctg
ccgatttcccatgacgaagtggttcatggcaaacgctcgctgatcgacaagatgcccggt
gaccgctggcagaaattcgccaacctgagggcctacctcagcttcatgtggggccatccc
ggcaagaagctgttgttcatgggctgtgagttcggccaatggcgcgagtggaaccacgac
cagcaattggactggtacctgctgcaataccctgagcaccgtggcgtgcagaaactggtg
agtgacctgaaccggctgtatcgcgaagaaccggcgctgcacgaccaggatgatgcgccc
cagggtttccagtggttgattggtgacgatgcgctcaacagcgtctacgcctggctgcgc
tggagcaaggagggccggccggtgctggtggtcgccaacttcacaccggtgccgcgcgag
gcctaccgggtcggcgtgccgttcggcgggcgctgggtcgaattgctcaacagcgatgcc
gacacctacgccggttccaactatggcaatggcggtggtgcctccaccgaagaagtgccc
agccatggccaggccctgtcactggaactcaacttgccgccattggcggtattgatcctg
cggccggagggttag

DBGET integrated database retrieval system