KEGG   Pseudomonas fluorescens F113: PSF113_3254Help
Entry
PSF113_3254       CDS       T01734                                 

Gene name
chlI
Definition
protein ChlI (EC:3.6.1.3 6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pfe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PSF113_3254 (chlI)
Enzymes [BR:pfe01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     PSF113_3254 (chlI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3836341..3837348
Genome map
AA seq 335 aa AA seqDB search
MTHTPHFPLCAVVGADDLKLALCLAAIDPKIGGVLIEGPRGMAKSTLARGLADLLASGQF
VTLPLGATEERLVGTLDLDAALGEGRAQFSPGVLAKADGGVLYVDEVNLLPDHLVDLLLD
VAASGINLIERDGISHRHPARFVLIGTMNPEEGELRPQLLDRFGLNVALDGHTAPAERGQ
IIRRRLDFDSDSLAFCAAWETAQQQLRDRCQQARDRLAGIALDDAALVQITERCFAAGVD
GLRADLVWLRAARAHAAWRGAGAIADEDIDAVAEFALRHRRRGHSAPAPAPSQAPTGAEK
TVEPNEEGQGQWGDLPARALPTGARRDVPSWPKKP
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgacccacaccccccatttcccgctctgcgccgtggtcggtgccgatgatctgaaactg
gccctgtgcctggccgcgatcgacccaaaaatcggcggtgtgctgatcgaagggccgcgg
ggcatggccaagtccacgttggcccggggcctggcggacctgctggccagcggtcagttc
gtcaccttgcccctcggtgctaccgaagagcggctggtgggtaccctggacctggacgcc
gcgctgggggaagggcgcgcgcagttttctcccggcgtgttggccaaggccgacggtggc
gtgctgtacgtcgatgaagtgaacctgctgcccgatcacctggtggacttgctgctcgat
gtggccgccagcggtatcaacctgatcgagcgcgacggcatttcccatcggcatccggcg
cgctttgtgctgatcggcaccatgaacccggaggagggtgagttgcgcccgcagttgctc
gaccgttttggcttgaacgtcgccctcgacggtcacaccgcaccggctgagcgcggccag
atcatccggcggcggctggatttcgacagcgattcactggcgttctgcgcggcgtgggag
acggcccagcagcagttgcgtgaccgttgccaacaggcacgcgaccgcttggccgggatc
gccctggatgatgcggcgctggtgcagatcaccgagcgctgttttgccgctggggtcgat
ggcttgcgcgccgacctggtctggcttcgggcggcccgggcccatgcggcctggcgcggg
gccggcgcgatagccgatgaagacatcgatgcggtcgccgaatttgccttgcgtcaccga
cggcgcgggcattcggcaccagcaccagcaccgtcccaggcgccgacgggggcggaaaaa
accgttgaacccaacgaagaaggccagggccagtggggcgacctgccggcccgggcattg
ccgaccggtgcccggcgtgacgtgccgagctggccaaaaaagccctag

DBGET integrated database retrieval system