KEGG   Pseudomonas fluorescens F113: PSF113_3271Help
Entry
PSF113_3271       CDS       T01734                                 

Definition
D-beta-hydroxybutyrate dehydrogenase (EC:1.1.1.30 3.6.1.15)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfe00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    PSF113_3271
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    PSF113_3271
Enzymes [BR:pfe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     PSF113_3271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3854551..3855327)
Genome map
AA seq 258 aa AA seqDB search
MTTPLSGKTALVTGSTSGIGLGIALSLAKAGANLILNGFGDASVVIAEVKQFGGKVGHHP
ADVSDPAQIADMLAYAEREFGGVDILVNNAGIQHVAAVEDFPVERWNSIIAINLSSVFHA
TRLSLPGMRAKGWGRIINVASVHGQVGSVGKAAYVAAKHGVIGLTKVVGLETATSNVTCN
AICPGWVLTPLVQKQIDDRIATGVDPQQAQHDLLAEKQPSLEFVTPPQLGELVLFLCSEA
GSQVRGAAWNIDGGWLAQ
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgacaacccctctttcgggcaagaccgccctggtcaccggttctaccagcggcatcggc
ctgggcattgccctgagcctggccaaggccggggccaacctgatcctcaacggctttggc
gacgcctcagtggtgatcgccgaggtgaaacagtttggcggcaaggtcggtcatcatcca
gccgatgtcagcgacccagcgcagatcgccgacatgctcgcctacgccgagcgcgagttc
ggcggcgtggacatcctggtgaacaacgccgggatccagcacgtggccgccgtggaggat
ttcccggtggagcgctggaactcgatcattgccatcaacctgtcctcggtgttccacgcc
acccgcctgagcctgccgggcatgcgtgccaagggctgggggcggattatcaacgtcgcc
tcggtgcacggccaggtcggctcggtgggcaaggcggcgtatgtcgcggccaagcatggg
gtgatcggtctgaccaaggtggtcggcctggaaaccgccaccagcaacgtgacctgcaac
gccatctgcccgggctgggtgctgacgccgctggtgcaaaaacagatcgatgatcgcatt
gccaccggcgtcgatccgcaacaggcacagcatgacctgctggccgagaaacagccgtcc
ctggaattcgtcaccccaccgcaactgggggaactggtgctgttcctgtgcagcgaagcc
ggcagccaggtgcgcggcgcggcgtggaatatcgatggtgggtggttggctcaataa

DBGET integrated database retrieval system