KEGG   Pseudomonas fluorescens F113: PSF113_3359Help
Entry
PSF113_3359       CDS       T01734                                 

Definition
limonene--epoxide hydrolase
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pfe00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PSF113_3359
Enzymes [BR:pfe01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.8  limonene-1,2-epoxide hydrolase
     PSF113_3359
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3956755..3957204
Genome map
AA seq 149 aa AA seqDB search
MALEQERFILDMLAAWGDGSDGSRPDIDRIMATFADNAVWQLWVPGGPVIRGHAALRREI
ERQMSYVTHNRCTTRHIVSSERVVMTERDDYCVSNGIPMPHSMVAVYELDENGLICAWRE
YLDTADLARKKGVPLEQVGGPGAGVTDTH
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atggcactcgaacaggaacgcttcatcctcgacatgctggccgcctggggcgatggcagc
gacggcagccgccccgatatcgaccgcatcatggccaccttcgccgacaacgccgtctgg
caactgtgggtgccgggtggcccggtgatccgcgggcatgctgcgttgcgtcgcgagatc
gagcggcagatgagttatgtcacgcataaccgctgcaccacgcgccacattgtctcttcc
gagcgcgtggtgatgaccgagcgcgacgattactgcgtcagcaatggcatccccatgccg
cactcgatggtggcggtgtatgagctggatgaaaacgggctcatctgtgcctggcgcgag
tacctggacaccgccgaccttgccaggaaaaaaggcgtgccgctggaacaggtgggcggg
cctggcgctggagtgaccgacacccattga

DBGET integrated database retrieval system