KEGG   Pseudomonas fluorescens F113: PSF113_3413Help
Entry
PSF113_3413       CDS       T01734                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pfe00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PSF113_3413
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PSF113_3413
Enzymes [BR:pfe01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PSF113_3413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4013699..4014250
Genome map
AA seq 183 aa AA seqDB search
MNNSLYDIPLKKNDGSASRLGDYQGKVLLVVNVASKCGLTPQYEGLEKLYQSKKDQGFEV
LGFPANNFREQEPGSDAEIVEFCSVNYDVHFPLFSKISVVGADQHPLYTQLTGSQPEAIG
DGPFRERLKGYGIESANTTDVLWNFEKFLIDRHGAVVARFAPDVTADDPRLLDAINTQLA
KEA
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgaataactccctttatgacattcctttgaaaaaaaacgatggcagtgccagccgcctg
ggcgactaccagggcaaagttctgctggtggtcaacgtcgcttcaaaatgcggcctgacc
ccgcaatacgaggggttggaaaagctgtaccaaagtaaaaaagaccaggggtttgaggtg
ttgggtttcccggccaataacttcagggaacaggagccggggagcgacgcggaaatcgtc
gagttctgttcggtcaactatgacgtccactttccgttgttctcgaaaatctcggtggtc
ggcgcggatcagcaccctctctacactcaactgactggctcgcaacctgaagccatcggt
gacggtccgttccgtgagcggttgaagggatatggcatcgagtcggccaacaccacggac
gtgctgtggaatttcgagaaatttttgatcgaccgccacggcgcggtggttgcgcgtttc
gctccggacgttacggcggatgaccctcggttgcttgacgcgataaatacacagttggcc
aaagaggcttag

DBGET integrated database retrieval system