KEGG   Pseudomonas fluorescens F113: PSF113_3716Help
Entry
PSF113_3716       CDS       T01734                                 

Definition
dihydrolipoamide acetyltransferase component (E2) of acetoin dehydrogenase complex (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pfe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSF113_3716
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSF113_3716
   00020 Citrate cycle (TCA cycle)
    PSF113_3716
   00620 Pyruvate metabolism
    PSF113_3716
Enzymes [BR:pfe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PSF113_3716
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4401249..4402361
Genome map
AA seq 370 aa AA seqDB search
MSQIHTLTMPKWGLSMTEGRVDAWLKEEGQAITKGDEVMDVETDKISSSVEAPFSGILRR
QIARQDETLAVGALLGIVVDGDASEAEIDAVIEQFQSTFVPGDAADEDSGPKPQKIELDG
RVIRYFERGEGGTPLLLVHGFGGDLNNWLFNHEALAVGRRVIALDLPGHGESSKTLQRGD
LDELSGVVLALLDHLDINAVHLVGHSMGGAVSLNAARLMPQRVRSLTLIGSAGLGAQING
SYLQGFVEAANRNALKPQLVQLFSNAELVNRQMLDDMLKYKRLEGVDAALQQLSATLFAD
GRQQVDLREVVQTGDVATLVIWGSDDAIIPAAHSDGLSAQVEVLSGQGHMVQMEAAEQVN
RLILGFIEQH
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgagccagattcataccctgaccatgcccaagtggggcttgtcgatgactgagggccgg
gtcgacgcctggctcaaggaggagggccaggccatcaccaagggcgatgaagtgatggac
gtggagaccgacaagatctccagcagcgtcgaagcgccgttttccggcatcctgcgccgc
cagatcgcccgccaggacgaaaccctggcggtcggcgccttgctcggcatcgtggtcgac
ggcgacgccagcgaggccgagatcgatgcggtcatcgagcagttccaatcgacctttgtg
cccggcgatgcggccgacgaagacagcgggccgaaaccgcagaaaatcgagttggacggt
cgggtgatccgctatttcgagcggggcgagggcggcacgccgttgttgctggtgcatggt
ttcggcggcgacctgaacaactggttgttcaaccatgaggcgttggcggttgggcgtcga
gtcattgcgctggacctgccgggccacggggaatcttcgaaaaccctgcaacgcggcgac
ctggacgaactgagcggcgtggtgctggccttgctcgatcacctggacatcaacgctgtg
catctggtggggcattccatgggtggggcggtgtcgctgaatgccgcacgcctgatgcct
cagcgagtccggtcgctgaccttgatcggcagcgccgggcttggcgcgcagatcaacggc
agctacctgcaaggttttgtcgaagcggccaaccgcaacgccctcaagccgcagctggtg
caactgttttccaatgccgaattggtcaaccgccagatgctcgacgacatgctcaagtac
aagcgcctggagggcgtggacgcggcgctgcagcaactgtctgcgacgttgttcgccgac
ggccgccaacaggtggatctgcgcgaagtggtgcagaccggcgacgtagcgaccctggtg
atctggggcagcgatgacgcgatcatcccggcggcccatagcgacgggctgagtgcccag
gtcgaggtgctgtccggccagggccacatggtgcaaatggaagcggccgagcaggtcaac
cggctgatcctcgggttcatcgagcagcactga

DBGET integrated database retrieval system