KEGG   Pseudomonas fluorescens F113: PSF113_3716Help
Entry
PSF113_3716       CDS       T01734                                 

Definition
(GenBank) Dihydrolipoamide acetyltransferase component (E2) of acetoin dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
pfe00010  Glycolysis / Gluconeogenesis
pfe00020  Citrate cycle (TCA cycle)
pfe00620  Pyruvate metabolism
pfe01100  Metabolic pathways
pfe01110  Biosynthesis of secondary metabolites
pfe01120  Microbial metabolism in diverse environments
pfe01130  Biosynthesis of antibiotics
pfe01200  Carbon metabolism
Module
pfe_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pfe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSF113_3716
   00020 Citrate cycle (TCA cycle)
    PSF113_3716
   00620 Pyruvate metabolism
    PSF113_3716
Enzymes [BR:pfe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PSF113_3716
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Biotin_lipoyl Hydrolase_4 Thioesterase PGAP1 Ndr HlyD_3 GCV_H Esterase DUF915 Abhydrolase_8 DUF1100 Ser_hydrolase Abhydrolase_5 Lipase_3
Motif
Other DBs
NCBI-ProteinID: AEV63717
UniProt: G8QCJ9
Position
4401249..4402361
Genome map
AA seq 370 aa AA seqDB search
MSQIHTLTMPKWGLSMTEGRVDAWLKEEGQAITKGDEVMDVETDKISSSVEAPFSGILRR
QIARQDETLAVGALLGIVVDGDASEAEIDAVIEQFQSTFVPGDAADEDSGPKPQKIELDG
RVIRYFERGEGGTPLLLVHGFGGDLNNWLFNHEALAVGRRVIALDLPGHGESSKTLQRGD
LDELSGVVLALLDHLDINAVHLVGHSMGGAVSLNAARLMPQRVRSLTLIGSAGLGAQING
SYLQGFVEAANRNALKPQLVQLFSNAELVNRQMLDDMLKYKRLEGVDAALQQLSATLFAD
GRQQVDLREVVQTGDVATLVIWGSDDAIIPAAHSDGLSAQVEVLSGQGHMVQMEAAEQVN
RLILGFIEQH
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgagccagattcataccctgaccatgcccaagtggggcttgtcgatgactgagggccgg
gtcgacgcctggctcaaggaggagggccaggccatcaccaagggcgatgaagtgatggac
gtggagaccgacaagatctccagcagcgtcgaagcgccgttttccggcatcctgcgccgc
cagatcgcccgccaggacgaaaccctggcggtcggcgccttgctcggcatcgtggtcgac
ggcgacgccagcgaggccgagatcgatgcggtcatcgagcagttccaatcgacctttgtg
cccggcgatgcggccgacgaagacagcgggccgaaaccgcagaaaatcgagttggacggt
cgggtgatccgctatttcgagcggggcgagggcggcacgccgttgttgctggtgcatggt
ttcggcggcgacctgaacaactggttgttcaaccatgaggcgttggcggttgggcgtcga
gtcattgcgctggacctgccgggccacggggaatcttcgaaaaccctgcaacgcggcgac
ctggacgaactgagcggcgtggtgctggccttgctcgatcacctggacatcaacgctgtg
catctggtggggcattccatgggtggggcggtgtcgctgaatgccgcacgcctgatgcct
cagcgagtccggtcgctgaccttgatcggcagcgccgggcttggcgcgcagatcaacggc
agctacctgcaaggttttgtcgaagcggccaaccgcaacgccctcaagccgcagctggtg
caactgttttccaatgccgaattggtcaaccgccagatgctcgacgacatgctcaagtac
aagcgcctggagggcgtggacgcggcgctgcagcaactgtctgcgacgttgttcgccgac
ggccgccaacaggtggatctgcgcgaagtggtgcagaccggcgacgtagcgaccctggtg
atctggggcagcgatgacgcgatcatcccggcggcccatagcgacgggctgagtgcccag
gtcgaggtgctgtccggccagggccacatggtgcaaatggaagcggccgagcaggtcaac
cggctgatcctcgggttcatcgagcagcactga

DBGET integrated database retrieval system