KEGG   Pseudomonas fluorescens F113: PSF113_3840Help
Entry
PSF113_3840       CDS       T01734                                 

Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pfe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSF113_3840
   00052 Galactose metabolism
    PSF113_3840
Enzymes [BR:pfe01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     PSF113_3840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4533218..4534369
Genome map
AA seq 383 aa AA seqDB search
MLESRQLLTALGVSLMIATSASQAAGLTNERGAFGKTDDGTAVEKFVLRNSHGVEATVIT
YGGILQSLSVPDKNGKAADIVLGFDDVQGYQKNGSVYFGATIGRFGNRLAGGAFELDGKR
YQVPQNDHGNSLHGGPQGFDKRVWKAQPHNAKDSVGVTLTYLSPDGEMGFPGALKTDVTY
SLNEQNELRIEYKATTDKPTVLNLTNHSYFNLAGAGNGDILEQLATLHAAHYTPVTGKLI
PTGELAPVAGTPMDFTQPTAIGTHIKADHPQLKFAEPKQGGFDFNWALDAKGDVNKLAAE
VYDTDSGRRLQLYTTEPGVQFYTSNFLDGTVKGKQGKVYPHWGAFTLETQHYPDSPNQPN
FPSTRLDPGQTYTQTMVLKFSAK
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaatccagacaactgctcacggccctcggagtgtccctgatgatcgccacctcg
gcttcccaggctgccggcctgaccaacgaacgcggtgcattcggcaagaccgacgacggc
acggcggtggaaaaattcgtgctgcgcaacagtcacggcgtggaggccacggtcatcacc
tacggcggcatcctccagtcattgagcgtgccggacaaaaacggcaaggccgccgacatc
gtgctcggcttcgacgacgtgcagggttaccagaagaacggcagcgtgtatttcggcgcg
accatcggccgctttggcaatcgcctggccggcggcgccttcgagctggacggcaagcgt
taccaagtgccgcagaacgaccatggcaactccctgcacggcgggccgcaagggttcgac
aagcgcgtctggaaggctcagccgcacaatgccaaggactcggtgggcgtcaccctgacc
tacctgtcacccgatggcgagatgggctttcccggtgcactgaagaccgacgtcacctac
agcctcaacgaacagaacgagttgcggatcgagtacaaagccaccaccgacaagcccaca
gtgctgaacctgaccaaccacagctatttcaacctggccggcgcaggcaacggcgacata
cttgagcagctcgcgaccctgcacgcggcccactacacgccggtcaccggcaaactcatt
cccaccggcgaactggcccccgtggctggtacgccgatggacttcacccaacccaccgcc
atcggcacccacatcaaggccgatcacccacaactcaaattcgccgaaccgaaacaaggc
ggcttcgatttcaactgggccctggacgccaaaggcgacgtgaacaaactggccgccgag
gtgtatgacacggactccggacgacgcctgcagctctacaccaccgaacccggcgtgcag
ttctacaccagcaacttcctcgacggcaccgtcaagggcaagcaaggcaaggtctatccg
cattggggcgcgttcaccctggaaacccagcactaccccgactcgcccaaccagccgaac
ttcccctcgacgcggcttgatccgggccagacctacacccagaccatggtgttgaagttc
tccgcaaaataa

DBGET integrated database retrieval system