KEGG   Pseudomonas fluorescens F113: PSF113_3979Help
Entry
PSF113_3979       CDS       T01734                                 

Gene name
nagZ
Definition
protein NagZ (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pfe00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PSF113_3979 (nagZ)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    PSF113_3979 (nagZ)
Enzymes [BR:pfe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     PSF113_3979 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4684942..4685952)
Genome map
AA seq 336 aa AA seqDB search
MTAGLQGSLMVDVAGTWLTAEDRHLLRQPEVGGLIIFARNIEHPRQVRELSASIRAIRPD
LLLAVDQEGGRVQRLRQGFVRLPAMRAIADNPNAEYLAEQCGWIMATEVLAVGLDLSFAP
VLDLDYQRSAVVGSRSFEGDPERAALLARAFIRGMNAAGMAATGKHFPGHGWAEADSHVA
IPNDERSLEQIRANDLVPFARLSKQLAAVMPAHVIYPQVDANPAGFSRRWLQDILRGELQ
FDGVIFSDDLSMAGAHVVGDAASRIEAALTAGCDMGLVCNDRAAAELALSAAQRLKVKPS
ARIARMRGQAYASTEYRQDPRWLTALGALKAAQLVD
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgactgctggcctgcaaggctcgttgatggtggacgtcgccggtacctggctgacggcc
gaagatcgccacctgttgcgccagcctgaggtaggcgggctgatcatctttgcccgcaat
atcgagcatccacgtcaggtgcgtgagttgagcgcgtcgatccgcgccatccgccctgac
cttttattggcggtggatcaggaaggtggtcgtgtccagcggctgcgccagggttttgtg
cggttgccggcgatgcgggcgatagccgacaaccctaacgctgaatacctggccgagcag
tgcggctggatcatggccactgaagtgctggcggtcggtctcgacctgagctttgccccg
gtgctggaccttgattaccagcgcagcgctgttgtcggcagtcgttccttcgaaggcgac
cccgagcgagcagcgttgttggcccgtgccttcatccgcggcatgaacgccgccgggatg
gccgccaccggcaagcatttcccggggcatggctgggccgaggccgattcccacgtggcg
attccgaacgacgagcgtagcctggagcagattcgcgccaacgacctggtaccgttcgcc
aggctgagcaagcaactggccgccgtcatgccggcccatgtcatctacccgcaggttgac
gccaatccagccgggttttcccgccgctggctgcaggacatcctgcgcggcgagttgcaa
ttcgatggcgtgatcttcagtgatgacctgtcgatggccggggctcatgtggtcggtgat
gctgccagtcgtatcgaggctgctttgacggcgggctgtgacatgggcctggtgtgcaac
gaccgtgctgccgcggagttggccttgagcgctgcccagcgcctgaaggtcaagccttcg
gcacggatcgcccgcatgcgcggccaggcctatgcctccactgaataccgtcaggaccct
cgctggctgacggcgctcggcgcgctgaaggctgcccagctggttgattaa

DBGET integrated database retrieval system