KEGG   Pseudomonas fluorescens F113: PSF113_3988Help
Entry
PSF113_3988       CDS       T01734                                 

Gene name
faoA
Definition
(GenBank) FaoA
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
pfe00071  Fatty acid degradation
pfe00280  Valine, leucine and isoleucine degradation
pfe00281  Geraniol degradation
pfe00310  Lysine degradation
pfe00362  Benzoate degradation
pfe00380  Tryptophan metabolism
pfe00410  beta-Alanine metabolism
pfe00640  Propanoate metabolism
pfe00650  Butanoate metabolism
pfe00903  Limonene and pinene degradation
pfe00930  Caprolactam degradation
pfe01040  Biosynthesis of unsaturated fatty acids
pfe01100  Metabolic pathways
pfe01110  Biosynthesis of secondary metabolites
pfe01120  Microbial metabolism in diverse environments
pfe01130  Biosynthesis of antibiotics
pfe01200  Carbon metabolism
pfe01212  Fatty acid metabolism
Module
pfe_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pfe00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PSF113_3988 (faoA)
   00650 Butanoate metabolism
    PSF113_3988 (faoA)
  Lipid metabolism
   00071 Fatty acid degradation
    PSF113_3988 (faoA)
   01040 Biosynthesis of unsaturated fatty acids
    PSF113_3988 (faoA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PSF113_3988 (faoA)
   00310 Lysine degradation
    PSF113_3988 (faoA)
   00380 Tryptophan metabolism
    PSF113_3988 (faoA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PSF113_3988 (faoA)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PSF113_3988 (faoA)
   00281 Geraniol degradation
    PSF113_3988 (faoA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PSF113_3988 (faoA)
   00930 Caprolactam degradation
    PSF113_3988 (faoA)
Enzymes [BR:pfe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     PSF113_3988 (faoA)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PSF113_3988 (faoA)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     PSF113_3988 (faoA)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     PSF113_3988 (faoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AEV63985
UniProt: G8PYY8
Position
complement(4693594..4695741)
Genome map
AA seq 715 aa AA seqDB search
MIYEGKAITVKALESDIVELKFDLKGESVNKFNRLTLNELRQAVDTIKADASIKGVIVSS
GKDVFIVGADITEFVDNFKLPDAELIAGNLEANRIFSDFEDLNVPTVVAINGIALGGGLE
MCLAADYRVMSTTAKIGLPEVKLGIYPGFGGTVRLPRLIGADNAIEWIAAGKENRAEDAL
KVGAVDAVVEPGKLQEAALETLKRAISGEFDYKAKRQPKLEKLKLNAIEQMMAFETAKGF
VAGQAGPNYPAPVEAIKTIQKAASFGRDKALEVEAAGFVKLAKTSAAQSLIGLFLNDQEL
KKKAKAYDEIASDVKQAAVLGAGIMGGGIAYQSASKGTPILMKDINEHGIEQGLAEAAKL
LVGRVDKGRMTAAKMAEVLNGIRPTLSYGDFGHVDLVVEAVVENPKVKQAVLAEVEDKVK
EDTILASNTSTISISLLAKALKRPENFVGMHFFNPVHMMPLVEVIRGEKSSEHAVATTVA
YAKKMGKNPIVVNDCPGFLVNRVLFPYFGGFAKLVSAGVDFVRIDKIMEKFGWPMGPAYL
MDVVGIDTGHHGRDVMAEGFPDRMKDDRRSAVDVLYEAKRLGQKNGKGFYAYETDKRGKQ
KKVADSSVLEVLKPIVYEQREVTDEDIINWMMIPLCLETVRCLEDGIVETAAEADMGLVY
GIGFPPFRGGALRYIDSIGVAEFVALADQYADLGALYHPTAKLREMAKNGQRFFG
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgatttacgaaggtaaagccatcacggttaaggctcttgaaagtgacatcgtcgaactg
aaattcgacctcaagggtgagtccgtcaacaagttcaaccgtctaaccctgaatgaattg
cgtcaggctgtagacactatcaaggcagatgcttcgatcaagggtgtgatcgtcagcagc
ggcaaggacgtgttcatcgtcggtgccgacatcaccgaattcgtcgataacttcaagctg
cccgatgccgaactgatcgctggcaacctcgaagccaaccgtattttcagcgacttcgaa
gacctcaacgtaccgaccgtcgtcgccatcaacggcatcgccctgggtggcggcctggaa
atgtgcctggcggcggattaccgcgtcatgtccaccacggccaagatcggcctgccggaa
gtcaagctgggcatctacccaggcttcggcggcaccgtgcgcctgccgcgcctgatcggt
gccgacaacgccatcgagtggattgccgccggcaaggaaaaccgtgctgaagacgcgctg
aaggtcggtgccgtggacgccgtggtcgaacctggcaagctccaggaagccgcccttgaa
accctcaagcgcgccatcagcggcgagttcgactacaaggccaagcgtcagccgaagctg
gaaaagctcaagctcaacgccatcgaacaaatgatggccttcgaaaccgccaagggtttt
gtggccggtcaggcaggcccgaactacccggcgccggtcgaagcgatcaagaccatccag
aaagccgcgagcttcggtcgtgacaaggccctggaagtcgaggccgcaggcttcgtcaag
ctggccaagacctcggctgcgcaaagcctgatcggtctgttcctcaatgaccaggagctg
aagaaaaaggccaaggcctacgacgaaatcgccagtgacgtgaagcaggccgccgtgctc
ggcgccggcatcatggggggcggcatcgcctaccagtcggcgtccaaaggcacgccgatc
ctgatgaaggacatcaacgaacacgggatcgagcagggcctggccgaagccgccaagctg
ctggtcggccgtgtcgacaaaggtcgcatgaccgctgcgaagatggccgaagtgctcaac
ggcattcgtccgaccctgtcctacggcgatttcggccatgtcgacctggtggtcgaagcc
gttgtcgagaacccgaaggtcaagcaggcggtattggctgaagtcgaagacaaggtcaaa
gaggacaccatcctggcctcgaacacgtcgaccatctccatttcgctgctggccaaggcc
ctcaagcgtccggagaacttcgtcggcatgcacttcttcaacccggtgcacatgatgccg
ctggtggaagtgatccgtggcgagaagtccagcgaacatgctgttgccaccaccgtggcc
tacgccaagaaaatgggcaagaacccgatcgtcgtcaacgactgcccgggctttttggtc
aaccgcgtgctgttcccgtacttcggcggtttcgccaagctggtcagcgccggtgtggac
ttcgtgcgcatcgacaagatcatggaaaaattcggctggccgatgggcccggcgtacctg
atggacgtggtcggcatcgacaccggccaccacggtcgcgacgtcatggccgaaggcttc
ccggaccgcatgaaggacgaccgtcgttcggctgtcgacgtgctctacgaagccaagcgc
ctgggccagaagaacggcaagggcttctacgcttatgagaccgacaagcgcggcaagcag
aagaaagtcgccgactcgtcggtgctggaagtgctcaagccgattgtctacgagcagcgc
gaagtcaccgacgaggacatcatcaactggatgatgatcccgctgtgcctcgaaaccgtg
cgttgcctggaagacggcattgtcgagaccgccgccgaagccgacatgggtctggtctac
ggtatcggtttccctccattccgtggcggtgcgctgcgctacatcgattcgatcggtgtc
gccgagttcgttgccctggctgaccagtacgctgatctgggcgcgctgtaccacccgacc
gcgaagctgcgtgaaatggccaagaacggccagcgcttcttcggttaa

DBGET integrated database retrieval system