KEGG   Pseudomonas fluorescens F113: PSF113_3988Help
Entry
PSF113_3988       CDS       T01734                                 

Gene name
faoA
Definition
protein FaoA (EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8)
Orthology
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pfe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSF113_3988 (faoA)
   01212 Fatty acid metabolism
    PSF113_3988 (faoA)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PSF113_3988 (faoA)
   00650 Butanoate metabolism
    PSF113_3988 (faoA)
  Lipid metabolism
   00071 Fatty acid degradation
    PSF113_3988 (faoA)
   01040 Biosynthesis of unsaturated fatty acids
    PSF113_3988 (faoA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PSF113_3988 (faoA)
   00310 Lysine degradation
    PSF113_3988 (faoA)
   00380 Tryptophan metabolism
    PSF113_3988 (faoA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PSF113_3988 (faoA)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PSF113_3988 (faoA)
   00281 Geraniol degradation
    PSF113_3988 (faoA)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    PSF113_3988 (faoA)
Enzymes [BR:pfe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     PSF113_3988 (faoA)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PSF113_3988 (faoA)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     PSF113_3988 (faoA)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     PSF113_3988 (faoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4693594..4695741)
Genome map
AA seq 715 aa AA seqDB search
MIYEGKAITVKALESDIVELKFDLKGESVNKFNRLTLNELRQAVDTIKADASIKGVIVSS
GKDVFIVGADITEFVDNFKLPDAELIAGNLEANRIFSDFEDLNVPTVVAINGIALGGGLE
MCLAADYRVMSTTAKIGLPEVKLGIYPGFGGTVRLPRLIGADNAIEWIAAGKENRAEDAL
KVGAVDAVVEPGKLQEAALETLKRAISGEFDYKAKRQPKLEKLKLNAIEQMMAFETAKGF
VAGQAGPNYPAPVEAIKTIQKAASFGRDKALEVEAAGFVKLAKTSAAQSLIGLFLNDQEL
KKKAKAYDEIASDVKQAAVLGAGIMGGGIAYQSASKGTPILMKDINEHGIEQGLAEAAKL
LVGRVDKGRMTAAKMAEVLNGIRPTLSYGDFGHVDLVVEAVVENPKVKQAVLAEVEDKVK
EDTILASNTSTISISLLAKALKRPENFVGMHFFNPVHMMPLVEVIRGEKSSEHAVATTVA
YAKKMGKNPIVVNDCPGFLVNRVLFPYFGGFAKLVSAGVDFVRIDKIMEKFGWPMGPAYL
MDVVGIDTGHHGRDVMAEGFPDRMKDDRRSAVDVLYEAKRLGQKNGKGFYAYETDKRGKQ
KKVADSSVLEVLKPIVYEQREVTDEDIINWMMIPLCLETVRCLEDGIVETAAEADMGLVY
GIGFPPFRGGALRYIDSIGVAEFVALADQYADLGALYHPTAKLREMAKNGQRFFG
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgatttacgaaggtaaagccatcacggttaaggctcttgaaagtgacatcgtcgaactg
aaattcgacctcaagggtgagtccgtcaacaagttcaaccgtctaaccctgaatgaattg
cgtcaggctgtagacactatcaaggcagatgcttcgatcaagggtgtgatcgtcagcagc
ggcaaggacgtgttcatcgtcggtgccgacatcaccgaattcgtcgataacttcaagctg
cccgatgccgaactgatcgctggcaacctcgaagccaaccgtattttcagcgacttcgaa
gacctcaacgtaccgaccgtcgtcgccatcaacggcatcgccctgggtggcggcctggaa
atgtgcctggcggcggattaccgcgtcatgtccaccacggccaagatcggcctgccggaa
gtcaagctgggcatctacccaggcttcggcggcaccgtgcgcctgccgcgcctgatcggt
gccgacaacgccatcgagtggattgccgccggcaaggaaaaccgtgctgaagacgcgctg
aaggtcggtgccgtggacgccgtggtcgaacctggcaagctccaggaagccgcccttgaa
accctcaagcgcgccatcagcggcgagttcgactacaaggccaagcgtcagccgaagctg
gaaaagctcaagctcaacgccatcgaacaaatgatggccttcgaaaccgccaagggtttt
gtggccggtcaggcaggcccgaactacccggcgccggtcgaagcgatcaagaccatccag
aaagccgcgagcttcggtcgtgacaaggccctggaagtcgaggccgcaggcttcgtcaag
ctggccaagacctcggctgcgcaaagcctgatcggtctgttcctcaatgaccaggagctg
aagaaaaaggccaaggcctacgacgaaatcgccagtgacgtgaagcaggccgccgtgctc
ggcgccggcatcatggggggcggcatcgcctaccagtcggcgtccaaaggcacgccgatc
ctgatgaaggacatcaacgaacacgggatcgagcagggcctggccgaagccgccaagctg
ctggtcggccgtgtcgacaaaggtcgcatgaccgctgcgaagatggccgaagtgctcaac
ggcattcgtccgaccctgtcctacggcgatttcggccatgtcgacctggtggtcgaagcc
gttgtcgagaacccgaaggtcaagcaggcggtattggctgaagtcgaagacaaggtcaaa
gaggacaccatcctggcctcgaacacgtcgaccatctccatttcgctgctggccaaggcc
ctcaagcgtccggagaacttcgtcggcatgcacttcttcaacccggtgcacatgatgccg
ctggtggaagtgatccgtggcgagaagtccagcgaacatgctgttgccaccaccgtggcc
tacgccaagaaaatgggcaagaacccgatcgtcgtcaacgactgcccgggctttttggtc
aaccgcgtgctgttcccgtacttcggcggtttcgccaagctggtcagcgccggtgtggac
ttcgtgcgcatcgacaagatcatggaaaaattcggctggccgatgggcccggcgtacctg
atggacgtggtcggcatcgacaccggccaccacggtcgcgacgtcatggccgaaggcttc
ccggaccgcatgaaggacgaccgtcgttcggctgtcgacgtgctctacgaagccaagcgc
ctgggccagaagaacggcaagggcttctacgcttatgagaccgacaagcgcggcaagcag
aagaaagtcgccgactcgtcggtgctggaagtgctcaagccgattgtctacgagcagcgc
gaagtcaccgacgaggacatcatcaactggatgatgatcccgctgtgcctcgaaaccgtg
cgttgcctggaagacggcattgtcgagaccgccgccgaagccgacatgggtctggtctac
ggtatcggtttccctccattccgtggcggtgcgctgcgctacatcgattcgatcggtgtc
gccgagttcgttgccctggctgaccagtacgctgatctgggcgcgctgtaccacccgacc
gcgaagctgcgtgaaatggccaagaacggccagcgcttcttcggttaa

DBGET integrated database retrieval system