KEGG   Pseudomonas fluorescens F113: PSF113_4239Help
Entry
PSF113_4239       CDS       T01734                                 

Definition
dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex (EC:2.3.1.61 2.3.3.8 6.2.1.5)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pfe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSF113_4239
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PSF113_4239
  Amino acid metabolism
   00310 Lysine degradation
    PSF113_4239
Enzymes [BR:pfe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PSF113_4239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4965280..4966500)
Genome map
AA seq 406 aa AA seqDB search
MAIEIKAPSFPESVADGTVATWHKKPGEAVKRDDLIVDIETDKVVLEVLAEADGVLGAII
AEEGATVLSNQVLGSIEEGGAAAAAPAAAAPAAAQAAAPAAGGEDDPVAAPAARKLAEEN
GINIASVAGTGKGGRVTKEDVVAAVAAKKAAPAAAPAKPAAPAAAAPVFAAGDRVEKRVP
MTRVRATVAKRLVEAQSNMAMLTTFNEVDMTEVMALRSKYKDLFEKSHNGVRLGFMSFFV
KAATEALKRFPAVNASIDGSDIVYHGYADIGVAVSSDRGLVVPVLRNAELMSLAEIEGGI
ATFGKKARDGKLSIEEMTGGTFTITNGGTFGSMMSTPIVNPPQAAILGMHNILQRPMAIN
GQVVIRPMMYLALSYDHRLIDGKEAVTFLVTIKNLLEDPARLLLDI
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaatcaaagccccgtcattcccggaatcggttgccgatggcaccgttgcc
acctggcacaagaaaccaggcgaggccgtcaagcgtgacgacctgatcgtcgacatcgag
accgacaaggtcgtgctggaagtattggccgaagctgacggcgtgctgggcgcaatcatt
gccgaggaaggcgctaccgttctgtcgaaccaggtcctgggctcgatcgaagagggcggc
gctgctgccgccgctccagccgccgctgcaccggctgccgctcaggctgctgctccagcc
gctggtggcgaagacgatcctgtcgctgcccctgctgctcgcaagctggctgaagagaat
ggcatcaacatcgcttccgttgccggcaccggcaagggtggtcgtgtgaccaaggaagac
gtggttgccgccgttgccgccaagaaagccgctccggccgccgcgccagccaagcctgcc
gcacctgccgctgccgctccggtgttcgctgccggtgaccgcgttgaaaaacgcgttccg
atgacccgcgttcgcgctaccgtggccaagcgtctggtagaagcccagtcgaacatggcg
atgctgactactttcaacgaagtcgacatgaccgaagtcatggctctgcgttcgaagtac
aaggatctgttcgagaagtcccacaacggcgtacgcctgggcttcatgtcgttcttcgtc
aaggctgccaccgaagcgctgaaacgcttcccggccgtcaacgcgtcgatcgacggttcc
gacatcgtctaccacggctacgccgatatcggtgttgctgtttccagcgaccgtggcctg
gtggttccggtactgcgtaacgccgaactgatgagcctggccgaaatcgaaggcggcatc
gccaccttcggcaagaaggcccgtgacggcaagctgtccatcgaagagatgaccggcggt
acgttcaccatcaccaacggtggtacattcggttcgatgatgtcgaccccgatcgtcaac
ccgccacaagcggctatcctgggcatgcacaacattctgcagcgtcctatggcgatcaat
ggtcaggtcgtgattcgtccgatgatgtacctggcactgtcctacgatcaccgcctgatc
gacggtaaagaagccgtgacgttcctggtaaccatcaagaacctgcttgaagatccggct
cgtctgctgctggatatctga

DBGET integrated database retrieval system