KEGG   Pseudomonas fluorescens F113: PSF113_4243Help
Entry
PSF113_4243       CDS       T01734                                 

Definition
Succinate dehydrogenase hydrophobic membrane anchor protein (EC:1.3.5.1 2.3.3.8 6.2.1.5)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
pfe  Pseudomonas fluorescens F113
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pfe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSF113_4243
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PSF113_4243
   00650 Butanoate metabolism
    PSF113_4243
  Energy metabolism
   00190 Oxidative phosphorylation
    PSF113_4243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4972131..4972499)
Genome map
AA seq 122 aa AA seqDB search
MVTNVTNLSRSGLYDWMAQRVSAVVLAAYFIFLIGYVVANPGIGYAQWHELFANNWMRIF
SLLALVALGAHAWVGMWTIATDYLTPMAFGKSATAVRFLFQAVCGVAMFAYFVWGVQILW
GI
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccaacgtcacgaacctttcgcgttcgggcctctacgactggatggcccagcgt
gtgtctgcggtcgttctcgcggcttacttcattttcctgatcggatatgtcgtggcaaac
cctggcattggctacgcccaatggcatgaactgttcgcaaacaactggatgcgcatcttc
agtctgctggcccttgtcgcactgggcgctcacgcctgggtcggtatgtggaccatcgcg
accgactacctgacgccaatggcgttcggcaagtcggcgactgccgtacgtttcctcttc
caggcagtatgcggcgttgcgatgttcgcttacttcgtctggggtgtgcagattctctgg
ggtatctga

DBGET integrated database retrieval system