KEGG   Pseudomonas fluorescens F113: PSF113_4326Help
Entry
PSF113_4326       CDS       T01734                                 

Gene name
folE2
Definition
protein FolE2 (EC:2.6.1.- 3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pfe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PSF113_4326 (folE2)
Enzymes [BR:pfe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     PSF113_4326 (folE2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5048512..5049057
Genome map
AA seq 181 aa AA seqDB search
MTLEQNYTAILGQLGEDVSREGLLDTPKRAAKAMQYLCRGYEQTLEEVTNGALFSSDNSE
MVLVKDIELYSLCEHHLLPFIGKAHVAYIPSGKVLGLSKVARIVDMYARRLQIQENLSRQ
IADAVQQVTGALGVAVVIEAKHMCMMMRGVEKQNSSMITSVMLGEFRENAATRSEFLSLI
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
gtgacactggaacagaactacaccgcgattctcggccaactgggcgaggacgtttcccgc
gagggcctgctcgacacgcccaagcgtgctgccaaggccatgcagtacctctgccgcggt
tatgaacagaccctggaagaagtcaccaacggtgccttgttcagctccgacaacagcgag
atggtgctggtcaaggacatcgagttgtactcgttgtgcgaacatcacctgctgcctttc
atcggcaaggctcacgtggcctacatcccgagcggcaaggtgctggggctatcgaaagtc
gcgcgcatcgtcgacatgtatgcgcgtcgcctgcagatccaggaaaacctcagccgccag
atcgccgatgcggtccagcaagtgactggcgccctgggcgtagcggtggtgatcgaagcc
aagcacatgtgcatgatgatgcgcggcgtggaaaagcagaattcctcgatgatcacctcg
gtgatgctcggcgagttccgggaaaacgccgccactcgcagcgaattcctcagcctcatc
aagtaa

DBGET integrated database retrieval system