KEGG   Pseudomonas fluorescens F113: PSF113_4419Help
Entry
PSF113_4419       CDS       T01734                                 

Gene name
purN
Definition
protein PurN (EC:2.1.2.2 6.3.3.1)
Orthology
K11175  
phosphoribosylglycinamide formyltransferase 1 [EC:2.1.2.2]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
Purine metabolism
One carbon pool by folate
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:pfe00230]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:pfe00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5160300..5160950
Genome map
AA seq 216 aa AA seqDB search
MSATCDVVVLLSGTGSNLQALIDSTRTGDSPVRIRAVISNRADAYGLQRAKEAGIDTRVL
DHKAFEGREAFDAALIEQIDTFNPQLVVLAGFMRILSAGFVRHYQGRLFNIHPSLLPKYK
GLHTHQRALEAGDTEHGCSVHFVTEELDGGPLVVQAVIPVELHDTPQSLAQRVHAREHQI
YPMAVRWFAEGRLTLDDRGASLDGQLLAASGHLIRY
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcaacctgtgacgtggtggtgctgctgtccggcaccggcagtaacttgcaggcc
ttgatcgacagcacacggaccggcgacagcccggtccgtatccgcgcggtgatttccaac
cgcgccgatgcctacggcctgcaacgcgccaaggaggcgggtatcgacacccgcgtcctg
gatcacaaggcgtttgagggccgcgaagccttcgacgccgcgctgatcgaacagatcgac
accttcaatccgcaactggtggtactcgctggcttcatgcgcatcctcagcgctggcttc
gtgcgtcactaccagggccgcctgttcaatatccatccctcgctgctgcccaaatacaaa
gggttacacactcaccagcgggcgctggaggccggagacacggagcacggctgctctgtg
cactttgtcaccgaggaactcgatggcggaccactggtcgtacaggcagtaataccggta
gagttgcacgacacgccgcaaagcctggcgcaacgggttcacgcccgcgagcaccagatc
tacccgatggccgtgcgttggtttgccgaaggaaggctgaccctcgacgatcgcggtgcc
tcactggacggccagttgctcgccgccagcggccatttgattcgatactag

DBGET integrated database retrieval system