KEGG   Pseudomonas fluorescens F113: PSF113_4495Help
Entry
PSF113_4495       CDS       T01734                                 

Gene name
acsA
Definition
acsA (EC:3.6.1.3 6.2.1.1 6.2.1.16)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pfe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSF113_4495 (acsA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSF113_4495 (acsA)
   00620 Pyruvate metabolism
    PSF113_4495 (acsA)
   00640 Propanoate metabolism
    PSF113_4495 (acsA)
  Energy metabolism
   00680 Methane metabolism
    PSF113_4495 (acsA)
Enzymes [BR:pfe01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PSF113_4495 (acsA)
Lipid biosynthesis proteins [BR:pfe01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PSF113_4495 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5251861..5253801)
Genome map
AA seq 646 aa AA seqDB search
MYPVRPEVAANTLTDEATYKAMYQQSVVNPDGFWREQAKRLDWIKPFTTVKQTSFDDHHV
DIKWFADGTLNVSYNCLDRHLAERGDQIAIIWEGDDPAESRNITYRELHEEVCKFANALR
GQDVHRGDVVTIYMPMIPEAVVAMLACARIGAIHSVVFGGFSPEALAGRIIDCKSKVVIT
ADEGVRAGKKIPLKANVDDALTNPETSSIQKVIVCKRTGGGIKWNQHRDIWYEDLMKVAG
TVCAPKEMGAEEALFILYTSGSTGKPKGVQHTTAGYLLYAALTHERVFDYKPGEVYWCTA
DVGWVTGHSYIVYGPLANGATTLLFEGVPNYPDITRVAKVVDKHKVSILYTAPTAIRAMM
ASGTAAVEGADGSSLRLLGSVGEPINPEAWDWYYKNVGKERCPIVDTWWQTETGGVLISP
LPGATALKPGSATRPFFGVVPALVDNLGNLIEGAAEGNLVILDSWPGQARTLYGDHDRFV
DTYFKTFSGMYFTGDGARRDEDGYYWITGRVDDVLNVSGHRMGTAEIESAMVAHPKVAEA
AVVGVPHDIKGQGIYVYVTLNAGEETSEALRLELKNWVRKEIGPIASPDVIQWAPGLPKT
RSGKIMRRILRKIATAEYDGLGDISTLADPSVVAHLIETHKTMNVA
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
gtgtatcccgttcgtcccgaggttgcggccaatacgctgactgacgaggcgacctacaag
gccatgtaccagcagtcggtcgtcaacccggacggcttctggcgcgagcaggccaagcgc
ctcgattggatcaagcctttcaccacggtgaagcagacgtccttcgacgatcaccatgtc
gacatcaagtggttcgccgacggcaccctgaacgtttcctacaactgcctcgaccgtcac
ttggccgagcgcggcgatcaaattgcgattatctgggagggcgatgaccctgccgagagc
cgtaacatcacctatcgcgagctgcatgaagaagtctgcaagttcgccaacgccctgcgc
ggccaggacgtgcaccgcggcgacgtggtgaccatctacatgccgatgatccctgaagcc
gtggtcgcgatgctggcctgtgcccggatcggtgcgattcactcggtggtgttcggcggt
ttctcgccggaagcgctggccggtcggatcatcgattgcaaatccaaagtggtgatcacc
gccgacgaaggcgttcgcgctggcaagaagatcccgctcaaggccaacgtcgatgacgcg
ttgaccaacccggaaaccagcagcatccagaaagtcatcgtgtgcaagcgcaccggtggt
ggcatcaagtggaaccagcaccgcgacatctggtacgaagacctgatgaaggtggccggt
accgtttgcgcgccgaaggaaatgggtgccgaggaagcgctgttcatcctctacacctcc
ggttccaccggcaagcccaagggcgtgcagcacaccacggccggctacttgctgtacgcg
gcgctgacccatgagcgagtgttcgactacaagccaggcgaagtgtactggtgcaccgcc
gacgtgggttgggtcaccggccacagctatatcgtctacggcccgctggccaatggtgcg
accacgttgctgttcgaaggcgtgccgaactacccggatatcacccgagtggccaaggtt
gtcgacaagcacaaggtcagcattctctacaccgcgccgaccgctatccgcgcgatgatg
gcctcgggcaccgccgccgtcgaaggtgctgacggcagcagcctgcgcctgttgggttcg
gtgggcgagccgatcaacccggaagcctgggactggtactacaagaatgtcggcaaggaa
cgttgcccgatcgtcgacacctggtggcagaccgaaaccggtggcgtgctgatcagccca
ctgccaggcgccacggcgttgaagccaggttcggccacgcgtccgttcttcggtgtggta
ccggcgttggtggacaacctcggcaacctgatcgaaggcgccgccgaaggcaacctggtg
atcctcgattcgtggccaggccaggcgcgtacgctgtacggcgaccatgaccgttttgtc
gacacctacttcaagaccttcagcggcatgtacttcaccggtgacggcgcgcgtcgtgac
gaggatggctactactggatcaccggtcgggtggatgacgtgctcaacgtgtccggccac
cgcatgggcacggccgagatcgagagcgccatggtcgcccacccgaaagtcgccgaagcg
gcggtggtcggtgtgccgcacgacatcaaggggcagggcatctacgtttacgtcaccctc
aatgccggcgaagaaaccagcgaggccctgcgtctggaactgaagaactgggtgcgcaag
gagatcggtccgattgcttcgccggatgtgatccagtgggcaccggggctgccgaaaacc
cgctccggcaagatcatgcgccgcatcctgcgcaagatcgccacggcggagtacgacggg
ttgggtgatatctccactctggctgatccgagtgtggtggcgcatctgatcgagacgcac
aagaccatgaacgttgcctga

DBGET integrated database retrieval system