KEGG   Pseudomonas fluorescens F113: PSF113_4495Help
Entry
PSF113_4495       CDS       T01734                                 

Gene name
acsA
Definition
(GenBank) AcsA
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
pfe00010  Glycolysis / Gluconeogenesis
pfe00620  Pyruvate metabolism
pfe00640  Propanoate metabolism
pfe00680  Methane metabolism
pfe01100  Metabolic pathways
pfe01110  Biosynthesis of secondary metabolites
pfe01120  Microbial metabolism in diverse environments
pfe01130  Biosynthesis of antibiotics
pfe01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pfe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSF113_4495 (acsA)
   00620 Pyruvate metabolism
    PSF113_4495 (acsA)
   00640 Propanoate metabolism
    PSF113_4495 (acsA)
  Energy metabolism
   00680 Methane metabolism
    PSF113_4495 (acsA)
Enzymes [BR:pfe01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PSF113_4495 (acsA)
Lipid biosynthesis proteins [BR:pfe01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PSF113_4495 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AEV64485
UniProt: G8Q6Q8
Position
complement(5251861..5253801)
Genome map
AA seq 646 aa AA seqDB search
MYPVRPEVAANTLTDEATYKAMYQQSVVNPDGFWREQAKRLDWIKPFTTVKQTSFDDHHV
DIKWFADGTLNVSYNCLDRHLAERGDQIAIIWEGDDPAESRNITYRELHEEVCKFANALR
GQDVHRGDVVTIYMPMIPEAVVAMLACARIGAIHSVVFGGFSPEALAGRIIDCKSKVVIT
ADEGVRAGKKIPLKANVDDALTNPETSSIQKVIVCKRTGGGIKWNQHRDIWYEDLMKVAG
TVCAPKEMGAEEALFILYTSGSTGKPKGVQHTTAGYLLYAALTHERVFDYKPGEVYWCTA
DVGWVTGHSYIVYGPLANGATTLLFEGVPNYPDITRVAKVVDKHKVSILYTAPTAIRAMM
ASGTAAVEGADGSSLRLLGSVGEPINPEAWDWYYKNVGKERCPIVDTWWQTETGGVLISP
LPGATALKPGSATRPFFGVVPALVDNLGNLIEGAAEGNLVILDSWPGQARTLYGDHDRFV
DTYFKTFSGMYFTGDGARRDEDGYYWITGRVDDVLNVSGHRMGTAEIESAMVAHPKVAEA
AVVGVPHDIKGQGIYVYVTLNAGEETSEALRLELKNWVRKEIGPIASPDVIQWAPGLPKT
RSGKIMRRILRKIATAEYDGLGDISTLADPSVVAHLIETHKTMNVA
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
gtgtatcccgttcgtcccgaggttgcggccaatacgctgactgacgaggcgacctacaag
gccatgtaccagcagtcggtcgtcaacccggacggcttctggcgcgagcaggccaagcgc
ctcgattggatcaagcctttcaccacggtgaagcagacgtccttcgacgatcaccatgtc
gacatcaagtggttcgccgacggcaccctgaacgtttcctacaactgcctcgaccgtcac
ttggccgagcgcggcgatcaaattgcgattatctgggagggcgatgaccctgccgagagc
cgtaacatcacctatcgcgagctgcatgaagaagtctgcaagttcgccaacgccctgcgc
ggccaggacgtgcaccgcggcgacgtggtgaccatctacatgccgatgatccctgaagcc
gtggtcgcgatgctggcctgtgcccggatcggtgcgattcactcggtggtgttcggcggt
ttctcgccggaagcgctggccggtcggatcatcgattgcaaatccaaagtggtgatcacc
gccgacgaaggcgttcgcgctggcaagaagatcccgctcaaggccaacgtcgatgacgcg
ttgaccaacccggaaaccagcagcatccagaaagtcatcgtgtgcaagcgcaccggtggt
ggcatcaagtggaaccagcaccgcgacatctggtacgaagacctgatgaaggtggccggt
accgtttgcgcgccgaaggaaatgggtgccgaggaagcgctgttcatcctctacacctcc
ggttccaccggcaagcccaagggcgtgcagcacaccacggccggctacttgctgtacgcg
gcgctgacccatgagcgagtgttcgactacaagccaggcgaagtgtactggtgcaccgcc
gacgtgggttgggtcaccggccacagctatatcgtctacggcccgctggccaatggtgcg
accacgttgctgttcgaaggcgtgccgaactacccggatatcacccgagtggccaaggtt
gtcgacaagcacaaggtcagcattctctacaccgcgccgaccgctatccgcgcgatgatg
gcctcgggcaccgccgccgtcgaaggtgctgacggcagcagcctgcgcctgttgggttcg
gtgggcgagccgatcaacccggaagcctgggactggtactacaagaatgtcggcaaggaa
cgttgcccgatcgtcgacacctggtggcagaccgaaaccggtggcgtgctgatcagccca
ctgccaggcgccacggcgttgaagccaggttcggccacgcgtccgttcttcggtgtggta
ccggcgttggtggacaacctcggcaacctgatcgaaggcgccgccgaaggcaacctggtg
atcctcgattcgtggccaggccaggcgcgtacgctgtacggcgaccatgaccgttttgtc
gacacctacttcaagaccttcagcggcatgtacttcaccggtgacggcgcgcgtcgtgac
gaggatggctactactggatcaccggtcgggtggatgacgtgctcaacgtgtccggccac
cgcatgggcacggccgagatcgagagcgccatggtcgcccacccgaaagtcgccgaagcg
gcggtggtcggtgtgccgcacgacatcaaggggcagggcatctacgtttacgtcaccctc
aatgccggcgaagaaaccagcgaggccctgcgtctggaactgaagaactgggtgcgcaag
gagatcggtccgattgcttcgccggatgtgatccagtgggcaccggggctgccgaaaacc
cgctccggcaagatcatgcgccgcatcctgcgcaagatcgccacggcggagtacgacggg
ttgggtgatatctccactctggctgatccgagtgtggtggcgcatctgatcgagacgcac
aagaccatgaacgttgcctga

DBGET integrated database retrieval system