KEGG   Pseudomonas fluorescens F113: PSF113_4578Help
Entry
PSF113_4578       CDS       T01734                                 

Definition
glycerol kinase (EC:2.7.1.30 3.6.1.15)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pfe  Pseudomonas fluorescens F113
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfe00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    PSF113_4578
Enzymes [BR:pfe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     PSF113_4578
Exosome [BR:pfe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PSF113_4578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5331368..5332873
Genome map
AA seq 501 aa AA seqDB search
MTDIQNKNYIIALDQGTTSSRAIIFDRDANVVCTAQREFAQHYPQAGWVEHDPMEIFATQ
SAVMVEALAQAGLHHDQVAAIGITNQRETTVVWDKTTGRPIYNAIVWQCRRSTEICQQLK
RDGHEQYISQTTGLVTDPYFSGTKLKWILDNVEGSRERARNGELLFGTVDSWLIWKFTGG
KVHVTDYTNASRTMLFNIHSLEWDAKMLDILDIPREMLPQVKSSSEIYGRTKSGIAIGGI
AGDQQAALFGQMCVEPGQAKNTYGTGCFLLMNTGKKAVKSNHGMLTTIACGPRGEVAYAL
EGAVFNGGSTVQWLRDELKIINDALDTEYFANKVKDSNGVYLVPAFTGLGAPYWDPYARG
ALFGLTRGVRVDHIIRAALESIAYQTRDVLDAMQQDSGERLKALRVDGGAVANNFLMQFQ
ADILGTQVERPKMRETTALGAAYLAGLACGFWGSLEELRGKAVIEREFEPQLDEQAKEKL
YAGWQKAVSRTRDWEPHEDAE
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatatccagaacaagaactacatcattgccctcgaccagggtacgaccagctcg
cgcgcgatcatcttcgaccgtgacgccaacgtggtctgcaccgcccagcgcgaattcgcc
cagcattacccgcaggccggctgggtcgaacatgacccgatggaaatcttcgccacccag
agcgcggtcatggtcgaagccctcgcccaggctggcctgcaccatgaccaggtggccgcc
atcggcatcaccaaccaacgtgaaaccaccgtggtctgggacaaaaccaccggccgcccg
atctacaacgccatcgtctggcaatgccgccgcagcaccgaaatctgccagcagctcaag
cgcgatggccacgagcaatacatcagccaaaccaccggtctggtcaccgacccgtacttt
tccggcaccaagctcaagtggatcctggacaacgtcgaaggcagccgcgagcgtgcgcgc
aacggtgaactgctgttcggcaccgtcgacagctggctgatctggaaattcaccggcggc
aaggtccacgtcaccgactacaccaacgcctcgagaaccatgctattcaacattcactcg
ctggaatgggacgcgaagatgctcgacatcctcgacatcccccgcgaaatgctcccgcaa
gtgaaatcgtcctcggagatctatggccgcaccaagagcggcatcgccatcggcggcatt
gccggcgaccagcaggcggcgcttttcggccagatgtgcgtggagccgggccaggcgaaa
aacacctacggcaccggctgcttcctgctgatgaacaccggtaaaaaggccgtgaaatcc
aatcacggcatgctcaccaccatcgcctgcggcccacgcggcgaagtcgcctacgccctg
gaaggtgcggtcttcaatggcggttccacagtccagtggctgcgcgatgaactgaagatc
atcaacgacgcgctggataccgaatactttgccaacaaggtcaaggacagcaacggcgtg
tacctggtgcccgccttcaccggcctgggcgcaccatactgggacccctatgcccgcggc
gcgctgtttggcctgacccgcggcgtacgggtcgatcacatcattcgcgcagcgctggag
tcgattgcctaccagacccgcgacgtactcgacgccatgcagcaggattcgggtgaacgc
ctcaaggccctgcgcgtcgatggtggcgcggtggcgaacaacttcctgatgcagttccag
gccgacatcctgggtacccaggtcgagcgcccgaaaatgcgtgaaaccaccgccttgggc
gcggcgtacctggccggcctggcgtgcggcttctggggcagcctggaagaactgcgcggc
aaagcggtgatcgagcgcgaattcgaaccgcaactggacgaacaggcgaaggaaaaactc
tacgctggctggcagaaggcggtcagccgcacccgtgactgggagccccacgaagacgct
gaataa

DBGET integrated database retrieval system